KEGG   Mycobacterium tuberculosis Erdman = ATCC 35801: ERDMAN_2796Help
Entry
ERDMAN_2796       CDS       T02526                                 

Gene name
aroF
Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
mtn  Mycobacterium tuberculosis Erdman = ATCC 35801
Pathway
mtn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtn01100  Metabolic pathways
mtn01110  Biosynthesis of secondary metabolites
mtn01130  Biosynthesis of antibiotics
mtn01230  Biosynthesis of amino acids
Module
mtn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ERDMAN_2796 (aroF)
Enzymes [BR:mtn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     ERDMAN_2796 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: BAL66580
UniProt: A0A0H3LG61
LinkDB All DBs
Structure
PDB: 

Position
complement(2850794..2852032)
Genome map
AA seq 412 aa AA seqDB search
MAAGGAWEDGQVLRWITAGESHGRALVAVVEGMVAGVHVTSADIADQLARRRLGYGRGAR
MTFERDAVTVLSGIRHGSTLGGPIAIEIGNTEWPKWETVMAADPVDPAELADVARNAPLT
RPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVLSHVIS
IGASAPYEGPPPRAEDLPAIDASPVRAYDKAAEADMIAQIEAAKKDGDTLGGVVEAVALG
LPVGLGSFTSGDHRLDSQLAAAVMGIQAIKGVEIGDGFQTARRRGSRAHDEMYPGPDGVV
RSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDLATGDEAVAIHQRSDVCAVPA
AGVVVETMVALVLARAALEKFGGDSLAETQRNIAAYQRSVADREAPAARVSG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccggcggcgcatgggaagatggtcaggtgttgcgctggatcaccgcgggggag
tcacacggccgcgccttggtggccgtggtcgaaggcatggtcgccggcgtgcacgtcacc
tcggccgacatcgccgaccagctggcccgacgccggctgggctacggccgcggcgcacgg
atgacgttcgagcgcgacgcggtgaccgtgctgtccgggatacgccacggcagcaccctg
ggcgggcccatcgccatcgagatcggcaacaccgaatggcccaaatgggagaccgtgatg
gccgccgacccggtcgaccccgccgagctggccgacgtcgcacgcaacgccccgctcacc
cggccgcggccgggccacgccgactacgcgggcatgctcaaatacggcttcgacgacgcg
cggccggtgctggagcgggccagcgcccgcgagaccgccgcccgggtcgcggcgggcacg
gtcgcacgggcattcctgaggcaggcgctgggtgtcgaggtgctctcccacgtcatctcg
atcggcgcgtcggcaccctacgagggtccgccgccgcgggccgaggacctacccgccatc
gacgccagcccggtacgcgcctacgacaaggccgccgaggcggacatgatcgcccaaatc
gaggcggccaagaaagacggcgacaccctcggcggcgtggtggaggcggtcgcgctgggc
ctgccggtggggctggggtcgttcaccagcggcgaccatcggctcgacagccagctggcc
gccgccgtcatgggcatccaggcgatcaagggcgtggagatcggcgacggattccagacc
gcgcgccgccgcggcagccgcgcccacgacgagatgtaccccgggcccgacggcgtcgtc
cgctccaccaaccgggccggggggctggaaggcgggatgaccaacgggcagccgctgcgg
gtgcgtgcggcgatgaagccgatctccacggtgccgcgcgcgctggccaccgtcgacctg
gcgaccggcgatgaggccgtcgccatccatcagcgctcggatgtgtgcgcggtgccggcg
gccggggtcgtggtggagaccatggtggcgttggtgctggcccgggcggcgctggaaaaa
ttcggcggggattcgctggccgaaacccagcgcaacatcgccgcctaccagcgcagcgtc
gccgaccgcgaagcaccggccgcgcgggtctccggttaa

DBGET integrated database retrieval system