KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_0129Help
Entry
MTCTRI2_0129      CDS       T01993                                 

Gene name
treS
Definition
(GenBank) trehalose synthase TRES
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
mto00500  Starch and sucrose metabolism
mto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MTCTRI2_0129 (treS)
Enzymes [BR:mto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MTCTRI2_0129 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MTCTRI2_0129 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AEM98574
LinkDB All DBs
Structure
PDB: 

Position
152455..154260
Genome map
AA seq 601 aa AA seqDB search
MNEAEHSVEHPPVQGSHVEGGVVEHPDAKDFGSAAALPADPTWFKHAVFYEVLVRAFFDA
SADGSGDLRGLIDRLDYLQWLGIDCIWLPPFYDSPLRDGGYDIRDFYKVLPEFGTVDDFV
ALVDAAHRRGIRIITDLVMNHTSESHPWFQESRRDPDGPYGDYYVWSDTSERYTDARIIF
VDTEESNWSFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMIDVIRFWLGLGIDGFRLDAV
PYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEANQWPGDVVEYFGDPNTGGD
ECHMAFHFPLMPRIFMAVRRESRFPISEIIAQTPPIPDMAQWGIFLRNHDELTLEMVTDE
ERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIELFTALLLSLPGSPVLYYGDEIGM
GDVIWLGDRDGVRIPMQWTPDRNAGFSTANPGRLYLPPSQDPVYGYQAVNVEAQRDTSTS
LLNFTRTMLAVRRRHPAFAVGAFQELGGSNPSVLAYVRQVAGDDGDTVLCVNNLSRFPQP
IELDLQQWTNYTPVELTGHVEFPRIGQVPYLLTLPGHGFYWFQLTTHEVGAPPTCGGERR
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggcagaacacagcgtcgagcaccctcccgtgcagggcagtcacgtcgaaggc
ggtgtggtcgagcatccggatgccaaggacttcggcagcgccgccgccctgcccgccgat
ccgacctggtttaagcacgccgtcttctacgaggtgctggtccgggcgttcttcgacgcc
agcgcggacggttccggcgatctgcgtggactcatcgatcgcctcgactacctgcagtgg
cttggcatcgactgcatctggttgccgccgttctacgactcgccgctgcgcgacggcggt
tacgacattcgcgacttctacaaggtgctgcccgaattcggcaccgtcgacgatttcgtc
gccctggtcgacgccgctcaccggcgaggtatccgcatcatcaccgacctggtgatgaat
cacacctcggagtcgcacccctggtttcaggagtcccgccgcgacccagacggaccgtac
ggtgactattacgtgtggagcgacaccagcgagcgctacaccgacgcccggatcatcttc
gtcgacaccgaagagtcgaactggtcattcgatcctgtccgccgacagttctactggcac
cgattcttctcccaccaaccggatctgaactacgacaaccccgccgtgcaagaggcgatg
atcgacgtcatccgcttttggctcggcttgggcatcgacgggtttcggttggacgcggtg
ccctatctctttgaacgtgagggcaccaactgcgagaacctgccggaaacacacgctttt
ctcaagcgagtccgcaaggtggtggacgacgaattccccggccgggtgctgctagccgaa
gccaatcagtggccgggcgatgtcgtcgaatatttcggtgatcccaacaccggtggcgac
gagtgccacatggcctttcacttcccgctgatgccgcgcatcttcatggccgtgcgccgg
gagtcccgttttccgatctcggagatcatcgcccagaccccaccaatccctgacatggcg
caatgggggatatttctgcgcaaccacgacgagctgacgttagaaatggtcaccgacgaa
gagcgcgactacatgtacgccgagtacgccaaggatccacggatgaaggcgaatgtcgga
atccgtcgtcggcttgcgccgctgctcgacaacgaccgcaaccagatcgagctgttcacc
gcgctgctgctgtcgctgcccggctcgccggtcctctactacggcgacgagatcgggatg
ggcgacgtgatctggttgggtgatcgcgacggcgtgcgcatcccgatgcagtggacaccg
gaccgcaacgcgggtttctccaccgccaacccgggtcggctgtacctgccgcccagccag
gacccggtttacgggtatcaggccgtcaacgtcgaggcgcaacgcgacacctcgacgtcg
ctgctcaacttcactcgcaccatgctggccgtgcgtcgccgacaccccgcgtttgcggtc
ggcgcattccaggaattgggcgggtccaacccgtcggtgctggcctacgtgcgtcaggtg
gccggcgatgacggcgacaccgtgctctgtgtcaacaacctgtcgcgattcccgcagccc
atcgaattggacttgcagcaatggaccaactacacgccggtcgagctgaccgggcacgtg
gagtttccacgcatcggccaggtgccctatctgctgacgctgccaggacacgggttctac
tggttccagttgaccacacatgaggtgggggcacctcccacttgcgggggagagcggcgc
ctatga

DBGET integrated database retrieval system