KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_0359Help
Entry
MTCTRI2_0359      CDS       T01993                                 

Gene name
dnaJ1
Definition
(GenBank) chaperone protein DnaJ
  KO
K03686  molecular chaperone DnaJ
Organism
mto  Mycobacterium tuberculosis CTRI-2
Brite
KEGG Orthology (KO) [BR:mto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mto03110]
    MTCTRI2_0359 (dnaJ1)
   03029 Mitochondrial biogenesis [BR:mto03029]
    MTCTRI2_0359 (dnaJ1)
Chaperones and folding catalysts [BR:mto03110]
 Heat shock proteins
  HSP40 / DNAJ
   MTCTRI2_0359 (dnaJ1)
Mitochondrial biogenesis [BR:mto03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    MTCTRI2_0359 (dnaJ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP
Motif
Other DBs
NCBI-ProteinID: AEM98802
LinkDB All DBs
Position
424799..425986
Genome map
AA seq 395 aa AA seqDB search
MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGNPAAGERFKAVSEAHN
VLSDPAKRKEYDETRRLFAGGGFGGRRFDSGFGGGFGGFGVGGDGAEFNLNDLFDAASRT
GGTTIGDLFGGLFGRGGSARPSRPRRGNDLETETELDFVEAAKGVAMPLRLTSPAPCTNC
HGSGARPGTSPKVCPTCNGSGVINRNQGAFGFSEPCTDCRGSGSIIEHPCEECKGTGVTT
RTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTVHVRPDKIFGRDGDDLTVTV
PVSFTELALGSTLSVPTLDGTVGVRVPKGTADGRILRVRGRGVPKRSGGSGDLLVTVKVA
VPPNLAGAAQEALEAYAAAERSSGFNPRAGWAGNR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaagggaatgggtcgaaaaagacttctaccaggagctgggcgtctcctctgat
gccagtcctgaagagatcaaacgtgcctatcggaagttggcgcgcgacctgcatccggac
gcgaacccgggcaacccggccgccggcgaacggttcaaggcggtttcggaggcgcataac
gtgctgtcggatccggccaagcgcaaggagtacgacgaaacccgccgcctgttcgccggc
ggcgggttcggcggccgtcggttcgacagcggctttgggggcgggttcggcggtttcggg
gtcggtggagacggcgccgagttcaacctcaacgacttgttcgacgccgccagccgaacc
ggcggtaccaccatcggtgacttgttcggtggcttgttcggacgcggtggcagcgcccgt
cccagccgcccgcgacgcggcaacgacctggagaccgagaccgagttggatttcgtggag
gccgccaagggcgtggcgatgccgctgcgattaaccagcccggcgccgtgcaccaactgc
catggcagcggggcccggccaggcaccagcccaaaggtgtgtcccacttgcaacgggtcg
ggcgtgatcaaccgcaatcagggcgcgttcggcttctccgagccgtgcaccgactgccga
ggtagcggctcgatcatcgagcacccctgcgaggagtgcaaaggcaccggcgtgaccacc
cgcacccgaaccatcaacgtgcggatcccgcccggtgtcgaggatgggcagcgcatccgg
ctagccggtcagggcgaggccgggttgcgcggcgctccctcgggggatctctacgtgacg
gtgcatgtgcggcccgacaagatcttcggccgcgacggcgacgacctcaccgtcaccgtt
ccggtcagcttcaccgaattggctttgggctcgacgctgtcggtgcctaccctggacggc
acggtcggggtccgggtgcccaaaggcaccgctgacggccgcattctgcgtgtgcgcgga
cgcggtgtgcccaagcgcagtgggggtagcggcgacctacttgtcaccgtgaaggtggcc
gtgccgcccaatttggcaggcgccgctcaggaagctctggaagcctatgcggcggcggag
cggtccagtggtttcaacccgcgggccggatgggcaggtaatcgctga

DBGET integrated database retrieval system