KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_3385Help
Entry
MTCTRI2_3385      CDS       T01993                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor subunit SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
mto00020  Citrate cycle (TCA cycle)
mto00190  Oxidative phosphorylation
mto00650  Butanoate metabolism
mto01100  Metabolic pathways
mto01110  Biosynthesis of secondary metabolites
mto01120  Microbial metabolism in diverse environments
mto01130  Biosynthesis of antibiotics
mto01200  Carbon metabolism
Module
mto_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mto_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mto_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MTCTRI2_3385 (sdhD)
   00650 Butanoate metabolism
    MTCTRI2_3385 (sdhD)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MTCTRI2_3385 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AEN01784
LinkDB All DBs
Position
3698814..3699248
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system