KEGG   Methanothrix thermoacetophila: Mthe_0177Help
Entry
Mthe_0177         CDS       T00417                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00970  Aminoacyl-tRNA biosynthesis
mtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mthe_0177
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mtp03029]
    Mthe_0177
Enzymes [BR:mtp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Mthe_0177
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Mthe_0177
Mitochondrial biogenesis [BR:mtp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mthe_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABK13976
UniProt: A0B5K2
LinkDB All DBs
Position
complement(169659..171074)
Genome map
AA seq 471 aa AA seqDB search
MLLQLKDEIRSGSAEEYLHRLFERIERSRLNAFTTLAKESALEAAREFDARPWGGALAGI
PVAIKDNICTRGIETTCSSRILKGFIPPYDAHVIERLRAEGAIIIGKTNMDEFAMGTSTE
TSCFGPTRNPWDLERVPGGSSGGSAAAVAAGEAPCALGSDTGGSVRCPASFCGTVGMKPT
YGLVSRYGLIAYANSLEQIGPITKTVEDAALLLDVIAGHDPRDSTSIASEGNYLSSIGRD
IRGICIGVPEEYFGEGVDPGVERAVWDAVSVLEGLGASWRKISLPHTKYALPAYYIIAMS
EASSNLARFDGLRYGLRVGEDKDWHTTFSEIRAMGFGKETKRRILLGTYALSAGYYGRYY
LKALKVRTLIKRDFEHALNKVDIIASPTMPFPAFKIGERITDPLSLYMSDVFTVPINLAG
IPAISVPCGFSDGLPVGLQLMARPFDEALLLRVANAYEQATPYHLRSPEVV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgcagctgaaggatgagatcaggtcaggatctgctgaggaatatctccacagg
ctcttcgagaggatagagcgcagcaggctgaatgcattcaccacgcttgcgaaggagagc
gccctggaagcggcgagggagttcgatgccaggccctggggcggcgcgctcgcaggaatt
cctgtggcgatcaaggacaacatctgcacgaggggcatagagacgacatgcagctcaagg
attctcaaagggttcatcccgccgtatgatgcccatgtgatagagcgtctcagggccgag
ggtgccataatcatcgggaagacgaacatggacgagttcgccatggggacatcaacagag
acgagctgtttcgggccgacgagaaacccctgggatctggagagggtgccaggagggtcc
agcggcggatctgcagccgcggtggcagcaggcgaggcgccatgcgcactcggctctgac
acaggaggttctgtcagatgccctgcatctttttgcggcactgttgggatgaagccgacc
tacggattggtctcgcgctacgggctgatcgcctatgcgaactctctggagcagatcgga
ccgatcacaaagaccgttgaggatgcggctcttctcctcgatgtcatagcaggtcacgat
ccaagagattccacatccatcgcatctgaagggaattatctcagcagcataggcagagat
atcagaggcatatgcatcggtgttccggaggaatactttggcgagggcgtagatccggga
gttgagcgggctgtgtgggacgcagtctcagtcctggaggggctgggcgcgagctggagg
aagataagccttccgcacaccaagtacgcgcttccggcgtattacataatagcgatgtcc
gaggcgtcgtccaaccttgccagatttgatggattgaggtatggattgagggttggcgag
gacaaggactggcacacgaccttctctgagatcagggcgatgggattcgggaaggagact
aagcggagaatactgctcggcacgtatgccctctctgctgggtactacggaaggtactat
ctgaaggctctgaaggtcaggactctcatcaaaagagatttcgagcatgcgctgaataag
gttgatataatagcatcgcccacgatgcccttccccgccttcaagatcggcgagaggata
acggatccgctatcactttacatgtcagatgtgttcacggtgcccataaacctggcgggc
atccccgcgatatcggtgccatgcggcttctcggatggtcttcctgtgggactgcagctc
atggcgaggcctttcgacgaggcactgcttctcagggtcgcgaacgcctatgaacaggca
acaccatatcatctcagatccccggaggtggtctga

DBGET integrated database retrieval system