KEGG   Methanothrix thermoacetophila: Mthe_0255Help
Entry
Mthe_0255         CDS       T00417                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00500  Starch and sucrose metabolism
mtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mthe_0255
Enzymes [BR:mtp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mthe_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: ABK14052
UniProt: A0B5S8
LinkDB All DBs
Position
complement(252248..253735)
Genome map
AA seq 495 aa AA seqDB search
MFEHMTDISISFEVHQPFRLKKEFFWSGSIFRRTRPHHDFYFDDIENRNVFERVAEKCYL
PANRIMLELIKRFSDTDRPFKVAYSLSGVFVEQCRRYRPDVLDTFIEMVDTGNVEILDQT
YYHSLTSLFDRKEFREQVRMHRELMWDIFGVKPTIFENTELIYNDEIAAMAEDMGYRGIF
AEGVIADPNHVYRPEGCRSISLLLRNYQLTDDIGFRFSSRNWEEFPLTADKYAAWLAATP
GRCINLFMDYETFGEHHWPETGIFEFLRCLPGEILKWKNLRFSTPAEIVERVEPSRTVSV
RSARSWADLERDTSCWLGNALQWACYTYLQNLQGPSREAGEDTLRIWRLLSLSDHLYYIF
THGGGPGEVHSYFSPYGNPYDAAVTYFSVLSDLHRRLSEILDMADHPFVLSTKDGAEIGT
AWSTQGMVNMLSRADTDTLEHHASLGSFATWASQSLGDERLARALRKASKLKGEDLRGAL
LDALNRRMKRSAKKS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagcatatgacagatatctccatcagcttcgaagtccatcagccattcaggctc
aaaaaggaattcttttggtcaggcagcatcttccggaggaccaggccgcatcatgatttc
tactttgatgatatagagaatcgcaacgtattcgagagggtggcagagaagtgctacctt
cccgcgaacaggatcatgctggagctcataaaacgtttctctgatacagatcgcccgttc
aaggtcgcatacagcctctcaggtgtgttcgtggagcagtgcagaaggtacagaccggat
gtactggatactttcatagagatggtggataccggcaatgtggagatactcgaccagacg
tactatcattcactcacaagcctcttcgacagaaaggagtttcgcgagcaggtgaggatg
cacagagaactcatgtgggacatctttggcgttaagcccacaatattcgagaacacagag
ctgatctacaatgatgagatcgcggcgatggctgaggatatgggctacagggggatattc
gcagagggcgtcattgctgatccgaatcacgtttacaggcctgaagggtgtaggagcatc
tcactgcttctcaggaattaccagctcaccgatgacatagggttcaggttctcatcgagg
aactgggaggagttcccgctcacagcggacaagtatgcagcatggctcgcagcaacccct
gggagatgcataaacctcttcatggactacgagacctttggggagcaccactggcctgag
acggggatattcgagtttctgagatgccttcccggagagatcctgaaatggaagaatctg
agattctccacgccagctgagatcgttgagagagtggagccctcgcgcaccgtgagcgtc
aggagcgccagatcatgggcggatctggagagggacacaagctgctggctcgggaacgcc
ctccagtgggcctgttacacatacctccagaatctccagggaccgtcgcgggaggccgga
gaggatacgctcagaatatggaggctcctcagcctgagcgatcacctctactacatattc
acacatggcggcggcccgggggaggtgcacagctacttcagcccctacgggaatccgtat
gatgctgctgttacatacttcagcgtcctctcagaccttcaccgtcgcctgtcagagatc
ctggacatggcagatcatccattcgtgctctccacaaaggatggcgcagagatcggaacc
gcctggagcacacagggaatggtgaatatgctcagcagagcggatacggatactctggag
catcacgcatcgctcggaagcttcgccacatgggcatcccagagcctaggtgacgagcgc
cttgccagagcactgagaaaagcatcaaagctgaagggcgaggatctcaggggtgctctg
ctggatgcactcaacaggagaatgaagaggtctgcaaaaaaatcgtga

DBGET integrated database retrieval system