KEGG   Methanothrix thermoacetophila: Mthe_0291Help
Entry
Mthe_0291         CDS       T00417                                 

Definition
(GenBank) acetyl-CoA decarbonylase/synthase epsilon subunit
  KO
K00195  anaerobic carbon-monoxide dehydrogenase, CODH/ACS complex subunit epsilon
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00680  Methane metabolism
mtp01100  Metabolic pathways
mtp01120  Microbial metabolism in diverse environments
mtp01200  Carbon metabolism
Module
mtp_M00422  Acetyl-CoA pathway, CO2 => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mthe_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CO_dh TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: ABK14088
UniProt: A0B5W4
LinkDB All DBs
Position
complement(290597..291145)
Genome map
AA seq 182 aa AA seqDB search
MAVDTTKNPIPFEMAQIPGPEMAKAYPVKVIGAIIKKAKRPLLVVGAELFDDPVMFDKAI
EIAKAKNMTIAATAHTIKGFIERGYTTNVYQIGLHPLTNYLRFKDWKGLDGQGHYDVVIF
MGIFYKFANAMFSALKHFNRDIKRVSIDRYYHVNADMTFGNLAFDSAGYHEAIDELIAIL
KK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgacacaaccaaaaaccccataccttttgagatggcccagatccccgggcct
gagatggcaaaggcctatcctgtgaaggtcataggcgccatcataaagaaggcaaagagg
ccgctgctggtcgtgggagcagagctcttcgacgacccggtcatgttcgataaggcgata
gagatcgccaaggctaagaacatgacgatcgctgcgacagctcacacgatcaagggcttc
atcgagagagggtacacgacgaacgtctatcagatcgggctgcatccgctgaccaactac
ctgcgattcaaggactggaagggtctggatgggcagggccactacgatgtggtcatcttc
atgggtatcttctacaagttcgcaaacgccatgttctctgcgctgaagcacttcaacagg
gatatcaagcgcgtctccatcgacaggtactaccatgtcaacgctgatatgacattcggg
aacctggcgttcgactctgcaggataccacgaggcgatcgatgagctgattgcaatactg
aagaagtga

DBGET integrated database retrieval system