KEGG   Methanothrix thermoacetophila: Mthe_0455Help
Entry
Mthe_0455         CDS       T00417                                 

Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K13831  3-hexulose-6-phosphate synthase / 6-phospho-3-hexuloisomerase [EC:4.1.2.43 5.3.1.27]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00030  Pentose phosphate pathway
mtp00680  Methane metabolism
mtp01100  Metabolic pathways
mtp01120  Microbial metabolism in diverse environments
mtp01200  Carbon metabolism
mtp01230  Biosynthesis of amino acids
Module
mtp_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mthe_0455
  09102 Energy metabolism
   00680 Methane metabolism
    Mthe_0455
Enzymes [BR:mtp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     Mthe_0455
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     Mthe_0455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like OMPdecase NanE NMO DUF561 His_biosynth Pterin_bind HMGL-like TMP-TENI PEP_hydrolase PEP_mutase ThiG PdxJ Dus FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABK14246
UniProt: A0B6C2
LinkDB All DBs
Position
471040..472326
Genome map
AA seq 428 aa AA seqDB search
MDIRPILQVALDLLEIDRAVEIAKEAIAGGADWIEAGTPLIKSEGMDAVRELRRTLPGVR
IVADMKTVDTGAMEVEMAAKAGADIVALLAISDDSTIQDAIRAARKYGVEIMVDLLSAPD
PVKRARELEELGVDYICVHVGIDQQMVGKSTIDLLREVVQVVSIPVAAAGGIDASSGKDA
IFYGASIVIVGGNITRSADVTGSARRIREAIDHVEGAGTSRRSLEEEMISIFREVSTPNI
TDAMHRKGAMRDILPIIPGTKIVGTAITVQTFEGDWAKTVEAIDEAGPGKVIVIYNGSRY
VAPWGGLATLSCMQKGVEGVVIDGAVRDVDEIRRLNYPVFASAIAPTAGEPKGMGEINVE
IVCGGQVVRPGDYIVGDDCGVVVIPKERAYEIARRAKEVEKNESRLFEEIRRGRTLSEVA
KLKKWEKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaggccgattctgcaggttgctctggatctcctggagatcgatcgggctgtt
gagatagcgaaggaggcgatagcgggcggtgcggactggatcgaggccggcacgcccctg
atcaagagcgagggtatggacgcggttcgagagctccggcgcacccttccaggagtcagg
attgtcgctgatatgaagaccgtggatacaggcgccatggaggtcgagatggctgcgaag
gccggcgcagatatcgtggctctgctcgcgatatcagatgactcaacgatacaggacgcg
attcgagctgcgaggaagtacggagtggagataatggtcgatctgctctcagcgcctgat
ccggtgaagcgcgcgagagagctcgaggagctcggagtggactacatctgtgtccacgtt
ggcatagatcagcaaatggttgggaagagcacaatagatctcctaagggaggtcgtccag
gtcgtcagcattccggtggctgcagcaggaggaatagacgcatcctctggaaaggatgcg
atcttctacggggcatctatcgtgatagtaggaggaaacataacaagatctgcagatgtc
actggctcagccaggcggatcagagaggcgatagatcatgtagagggcgctggcacctcc
cgaagaagcctggaggaggagatgatctccatattcagagaggtctccaccccgaacata
acggacgcgatgcaccgcaagggggcgatgcgggacatactcccgataattccggggacg
aagatcgtcggcaccgcgatcacggtccagacattcgagggagattgggcgaagaccgtg
gaggcgatagacgaggccgggcctgggaaggtcatcgtcatctacaacggcagccgctat
gtcgcgccgtggggagggttggcgacgctgagctgcatgcagaagggtgttgagggggtc
gtgatcgatggagctgtcagagatgtggacgagatccgcaggctcaattatcctgtgttc
gcaagcgccatagcccccactgcgggagagccgaagggaatgggggagataaatgtggag
atcgtctgcggagggcaggttgtgcgtccgggggattacatcgtgggggatgactgcggt
gtcgtggtgataccgaaggagagggcctacgagatcgcgagaagagctaaagaggtcgag
aagaacgagagcagactcttcgaggagataagaagagggaggacgctgtccgaggtcgca
aagctgaagaaatgggagaagctctga

DBGET integrated database retrieval system