KEGG   Mycobacterium tuberculosis HKBS1: HKBS1_0237Help
Entry
HKBS1_0237        CDS       T03154                                 

Definition
(GenBank) hypothetical protein
  KO
K00635  diacylglycerol O-acyltransferase / wax synthase [EC:2.3.1.20 2.3.1.75]
Organism
mtq  Mycobacterium tuberculosis HKBS1
Pathway
mtq00561  Glycerolipid metabolism
mtq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    HKBS1_0237
Enzymes [BR:mtq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     HKBS1_0237
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     HKBS1_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WES_acyltransf DUF1298 Condensation
Motif
Other DBs
NCBI-ProteinID: AHJ40883
LinkDB All DBs
Position
262334..263743
Genome map
AA seq 469 aa AA seqDB search
MKRLSGWDAVLLYSETPNVHIHTLKVAVIELDSDRQEFGVDAFREVIAGRLHKLEPLGYQ
LVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELDEAVGEIASTPLNRDHPLWEM
YFVEGLANHRIAVVAKIHHALADGVASANMMARGMDLLPGPEVGRYVPDPAPTKRQLLSA
AFIDHLRHLGRIPATIRYTTQGLGRVRRSSRKLSPALTMPFTPPPTFMNHRLTPERRFAT
ATLALIDVKATAKLLGATINDMVLAMSTGALRTLLLRYDGKAEPLLASVPVSYDFSPERI
SGNRFTGMLVALPADSDDPLQRVRVCHENAVSAKESHQLLGPELISRWAAYWPPAGAEAL
FRWLSERDGQNKVLNLNISNVPGPRERGRVGAALVTEIYSVGPLTAGSGLNITVWSYVDQ
LNISVLTDGSTVQDPHEVTAGMIADFIEIRRAAGLSVELTVVESAMAQA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggctcagcggctgggacgcggtactgctttacagcgagaccccgaatgtgcac
atacacacactcaaggtcgccgtgatcgaattggattcggacagacaggaattcggtgtc
gacgcgtttcgcgaggtgatcgctggccggctgcataagcttgagccattgggctatcag
ctggttgatgtcccgttgaagttccatcacccgatgtggcgggagcactgccaggtcgat
ctcaactaccacatccggccgtggcggttgcgcgccccggggggtcggcgcgaactcgac
gaggcggtcggagaaatcgccagcaccccgctgaaccgcgaccacccgctgtgggagatg
tacttcgttgaggggcttgccaaccaccggatcgcggtggttgccaaaattcaccatgcg
ttggctgacggtgttgcctcggcaaacatgatggcacgggggatggatctgctgccggga
ccggaggtcggccgctatgtgcctgaccccgctcctaccaagcggcagttgctgtccgcg
gcgttcatcgaccacttgcgccacctcggccggattcctgcaaccatccggtacaccacg
cagggtctaggccgggtgcgacgtagctcgcgcaagctctcacccgcactgaccatgcca
tttaccccgccaccgacgttcatgaatcaccggctcaccccggagcgcaggttcgccacc
gccaccctggcgctgattgacgtgaaggcgacggccaagttgctgggggcgacgatcaac
gacatggtgctggccatgtcgaccggcgctctgcgtaccctgctattgcgctatgacggc
aaggccgaaccgctgctggcgtcggtcccggtgagttacgacttctcaccggagcggatc
tccggtaaccgcttcaccggaatgctggtggcgctgcctgccgactccgacgacccgttg
cagcgggtgcgcgtctgtcacgaaaacgcggtctccgccaaggagagccaccagcttttg
ggaccggagttgatcagccgctgggcggcttactggccacctgccggtgcggaagccttg
ttccggtggttgtctgagcgcgacgggcagaacaaggtactcaacttgaatatctcgaat
gttcccggtccgcgcgaacgcggccgcgtgggggccgcgctggtcaccgagatctattcg
gtgggcccgttgaccgccggtagcggattgaatatcacggtgtggagttatgtcgatcag
ctcaatatctcggtgttaaccgatggttccaccgtgcaggacccgcatgaagtaaccgcg
ggaatgatcgcggacttcatcgaaatacgccgcgccgctggtctttccgtggagttgaca
gtcgtcgagtccgcgatggcgcaggcatga

DBGET integrated database retrieval system