KEGG   Mycobacterium tuberculosis HKBS1: HKBS1_0265Help
Entry
HKBS1_0265        CDS       T03154                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtq  Mycobacterium tuberculosis HKBS1
Pathway
mtq00020  Citrate cycle (TCA cycle)
mtq00190  Oxidative phosphorylation
mtq00650  Butanoate metabolism
mtq01100  Metabolic pathways
mtq01110  Biosynthesis of secondary metabolites
mtq01120  Microbial metabolism in diverse environments
mtq01130  Biosynthesis of antibiotics
mtq01200  Carbon metabolism
Module
mtq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HKBS1_0265
   00650 Butanoate metabolism
    HKBS1_0265
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HKBS1_0265
Enzymes [BR:mtq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HKBS1_0265
    1.3.5.4  fumarate reductase (quinol)
     HKBS1_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 GIDA Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AHJ40911
LinkDB All DBs
Position
complement(297131..299071)
Genome map
AA seq 646 aa AA seqDB search
MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKAHTVMAEGGCAAAMGN
ANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRTDDGRISQRN
FGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYEARIKVFAECTITELLKD
QGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNSWEYTGDGHALALRAGATL
INMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENSRFMFDYIPPVFKGQYAETE
EEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTPHGGVYLDIASRLTPAEIKRR
LPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDADTGAATVPGLFAAGECAGGMHG
SNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSAEAIDAAAQQALSPFEGPKDGSA
PENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAELWSRYHNVLVEGHRQYNPGWNLS
IDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMDPNWRRILLVCRATETMGTGGSGSG
DSNCHINVTQQLQTPMRPDLLELFEISELEKYYTDEELAEHPGRRG
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtcgagcggcactcctacgacgtagtcgtgatcggtgccggcggcgcgggg
ttacgcgcggtcatcgaggcgcgggaacgcggcttgaaagtagccgtcgtgtgcaaatcc
ctattcggcaaggcccacacggtcatggccgaaggcggctgcgcggccgcgatgggcaac
gccaacccgaaggacaattggaagactcacttcggcgacacgatgcgcggtggaaagttc
ctgaacaactggcgtatggccgagctgcacgccaaggaggcgccggaccgggtctgggag
ttggagacctacggcgcgctgttcgaccgcaccgacgatggccgaatcagtcagcgcaac
ttcggcggacacacctatccgcgactggcgcacgtcggcgaccgcaccggcctggagttg
atccgcaccctgcagcaaaaggttgtctcgctgcagcaggaggaccacgccgagctcggc
gactacgaagcgcggatcaaagtgttcgccgaatgcaccatcaccgaactgctcaaggac
caaggcgcgatcgccggagccttcggctactggcgggaaagcggccggttcatcgtgttc
gaggcgccagcggtggtgcttgccactggcgggatcggcaagtcgttcaaggtgacatcc
aactcctgggagtacaccggagacgggcacgcgttggcactgcgggccggggcgacgctg
atcaacatggagttcgtccagttccacccgacgggcatggtgtggccgcccagtgtcaag
ggaattctggtcactgagggtgttcgcggcgacggcggagtgctcaaaaactcggagaac
tctcgcttcatgttcgactacattccgccggtgttcaagggccagtacgccgagacggag
gaagaggccgaccagtggcttaaggacaacgactcggcccgacgcaccccggacttgctg
ccccgcgacgaggtcgcgcgcgcgatcaactcagaggtcaaggccggccgcggtaccccg
cacggcggcgtctacctcgacatcgcatcccggctgacacccgccgagatcaaacggcga
ttgccgtcgatgtatcaccagttcaaagagctcgctgaagtcgatatcacaacgcaggca
atggaagtcgggccgacgtgtcactacgtgatgggcggtgtcgaagtagacgcggacacc
ggcgccgccacggtgccaggcctgttcgctgccggtgagtgtgccggcggtatgcacggc
tccaaccggctgggcggcaattcgctgtccgatctgctggtattcggccggcgggccggc
ctgggcgcagcggattacgtacgggcactgagcagccggccagcggtttcagcggaggct
atcgatgcggcggcccagcaggcgctgagccccttcgaaggaccgaaagacggctcggcg
ccggagaatccgtacgcgctgcatatggacttgcagtacgtgatgaacgatctggtcggt
atcatccgcaacgccgacgaaatatccagggcgctgactcttttggccgagctgtggtcg
cgctaccacaacgtactcgtcgaaggtcaccgtcaatacaatccgggctggaacctgtcc
atcgacctgcgcaacatgttgctggtcagcgagtgcgtggccagagctgcgctacagcgc
accgaaagccgaggcggccacacccgagacgaccatcccggtatggaccccaactggcgc
aggatcttgctggtatgccgggccaccgaaaccatgggcaccggtggcagcgggtccggc
gactccaactgccacatcaacgtcacccagcagctgcaaacgcccatgcgacccgacttg
ctggagctcttcgagatctcggagttggagaaatactacaccgacgaagagctggccgag
catccaggacggagaggctaa

DBGET integrated database retrieval system