KEGG   Mycobacterium tuberculosis HKBS1: HKBS1_0981Help
Entry
HKBS1_0981        CDS       T03154                                 

Gene name
pstB
Definition
(GenBank) phosphate-transport ATP-binding protein ABC transporter
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
mtq  Mycobacterium tuberculosis HKBS1
Pathway
mtq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mtq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HKBS1_0981 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtq02000]
    HKBS1_0981 (pstB)
Enzymes [BR:mtq01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     HKBS1_0981 (pstB)
Transporters [BR:mtq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    HKBS1_0981 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_16 AAA_18 AAA_33 AAA_29 AAA_30 ATPase T2SSE AAA_25 cobW NB-ARC AAA_23 ATP_bind_1 TsaE RsgA_GTPase AAA_24 FtsK_SpoIIIE Pox_A32
Motif
Other DBs
NCBI-ProteinID: AHJ41627
LinkDB All DBs
Position
1039789..1040619
Genome map
AA seq 276 aa AA seqDB search
MACERLGGQSGAADVDAAAPAMAAVNLTLGFAGKTVLDQVSMGFPARAVTSLMGPTGSGK
TTFLRTLNRMNDKVSGYRYSGDVLLGGRSIFNYRDVLEFRRRVGMLFQRPNPFPMSIMDN
VLAGVRAHKLVPRKEFRGVAQARLTEVGLWDAVKDRLSDSPFRLSGGQQQLLCLARTLAV
NPEVLLLDEPTSALDPTTTEKIEEFIRSLADRLTVIIVTHNLAQAARISDRAALFFDGRL
VEEGPTEQLFSSPKHAETARYVAGLSGDVKDAKRGN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgtgaacggctcggcggccagagcggtgctgctgatgtcgacgccgctgcgccg
gcgatggcggcggtgaacctcaccctgggtttcgctggcaaaaccgtgctcgaccaggtg
agtatgggctttcccgctcgtgcggtgacgtcgttgatgggaccgaccggttcaggtaag
acgacttttttgcgcaccctaaaccggatgaatgacaaggtctccggttaccgctacagc
ggtgatgtgctgttgggcggacgcagcatcttcaactaccgcgacgtgctggagtttcgc
cgccgggttggcatgctgttccagcgcccgaatccgttcccgatgtcaatcatggacaac
gtgctcgccggcgtgcgtgcccacaaactggtgccgcgcaaggaattccgtggcgtcgcg
caggctcggcttaccgaggtcggcctctgggacgcggtcaaggatcggctcagcgattca
ccgtttcgactctctggtggtcagcagcagttgttgtgcctagcccgtacgcttgcggtg
aatccggaggtgttgctgctcgacgagcccacctccgcgctggacccgactaccaccgag
aagatcgaagagttcatccgatcgctcgctgatcgcctcacggtgatcatcgtgacccat
aaccttgcccaggccgcccgcatcagcgaccgggcggccctgttcttcgacggcaggctg
gtggaggaagggcccaccgaacagctgttctcctcgccgaagcatgcggaaaccgcccga
tacgtcgccggactgtcgggggacgtcaaggacgccaagcgcggaaattga

DBGET integrated database retrieval system