KEGG   Mycobacterium tuberculosis HKBS1: HKBS1_2687Help
Entry
HKBS1_2687        CDS       T03154                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
mtq  Mycobacterium tuberculosis HKBS1
Pathway
mtq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtq01100  Metabolic pathways
mtq01110  Biosynthesis of secondary metabolites
mtq01130  Biosynthesis of antibiotics
mtq01230  Biosynthesis of amino acids
Module
mtq_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HKBS1_2687 (aroB)
Enzymes [BR:mtq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     HKBS1_2687 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AHJ43333
LinkDB All DBs
Structure
PDB: 

Position
complement(2853557..2854645)
Genome map
AA seq 362 aa AA seqDB search
MTDIGAPVTVQVAVDPPYPVVIGTGLLDELEDLLADRHKVAVVHQPGLAETAEEIRKRLA
GKGVDAHRIEIPDAEAGKDLPVVGFIWEVLGRIGIGRKDALVSLGGGAATDVAGFAAATW
LRGVSIVHLPTTLLGMVDAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEM
ICGMAEVVKAGFIADPVILDLIEADPQAALDPAGDVLPELIRRAITVKAEVVAADEKESE
LREILNYGHTLGHAIERRERYRWRHGAAVSVGLVFAAELARLAGRLDDATAQRHRTILSS
LGLPVSYDPDALPQLLEIMAGDKKTRAGVLRFVVLDGLAKPGRMVGPDPGLLVTAYAGVC
AP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcggcgcacccgtgaccgtgcaggtggccgtcgatccgccatacccggtg
gtcatcggtaccggcctgctcgacgagctggaagacctgctggccgaccggcacaaggtc
gccgtcgtgcatcagcccggactagccgagaccgcggaagagatccgaaagcgcttggcc
ggcaagggcgtcgacgcgcaccgcatcgagatccccgacgccgaggccggcaaggacctg
cccgtcgtgggattcatctgggaggtgttgggccgcatcggaatcggccgcaaagacgcc
ctggtcagcctcggcggcggggccgccaccgacgtcgccgggttcgcggcggccacctgg
ctgcgcggcgtctcgattgtgcacctgcccaccacactgctgggcatggtcgatgcggcc
gtcggcggcaagaccggcatcaacaccgacgccggcaagaacctggtcggggcgtttcat
cagccgttggcggtcctggtggacctggcgacgctgcaaaccttgccacgcgacgaaatg
atctgcggcatggccgaagtggtcaaggccggcttcatcgccgacccggtgatcctggat
ctcatcgaagctgacccgcaggccgcactcgacccggccggcgacgtgctgcccgagctg
atccggcgcgcgatcaccgtcaaggccgaggtggtcgccgccgacgaaaaggaatccgag
ctgcgcgaaatcctcaactacggccacacattaggccacgcgatcgagcgccgggaacgc
taccggtggcgccacggcgccgccgtgtcggtggggctggtgttcgcggccgagctggcc
aggcttgccgggcggctcgacgacgcgaccgcgcagcgccaccgcaccatcctgtcctcg
ttgggattgccggtcagctacgacccggacgcgctgccccagctgctggaaatcatggcc
ggcgacaagaagactcgggcgggtgtgttgcggttcgtggtgctcgacggattggccaag
ccgggccgaatggtgggaccggaccccggtctgctggtaaccgcctacgccggagtttgc
gccccatga

DBGET integrated database retrieval system