KEGG   Mycobacterium tuberculosis HKBS1: HKBS1_3952Help
Entry
HKBS1_3952        CDS       T03154                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mtq  Mycobacterium tuberculosis HKBS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AHJ44597
LinkDB All DBs
Position
4178157..4179233
Genome map
AA seq 358 aa AA seqDB search
MQLPVMPPVSPMLAKSVTAIPPDASYEPKWDGFRSICFRDGDQVELGSRNERPMTRYFPE
LVAAIRAELPHRCVIDGEIIIATDHGLDFEALQQRIHPAESRVRMLADRTPASFIAFDLL
ALGDDDYTGRPFSERRAALVDAVTGSGADADLSIHVTPATTDMATAQRWFSEFEGAGLDG
VIAKPPHITYQPDKRVMFKIKHLRTADCVVAGYRVHKSGSDAIGSLLLGLYQEDGQLASV
GVIGAFPMAERRRLLTELQPLVTSFDDHPWNWAAHVAGQRTPRKNEFSRWNVGKDLSFVP
LRPERVVEVRYDHMEGARFRHTAQFNRWRPDRDPRSCSYAQLERPLTVSLSDIVPGLR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcagttacccgtcatgccgccggtgtcgccgatgctggccaaatcggtcaccgcaatc
ccgccggacgcgtcgtatgaacccaaatgggacggattccgctccatctgctttcgcgac
ggtgatcaggtcgaactgggtagccgcaacgagcggccgatgacccgctacttccccgag
ctggtcgccgcgatcagggccgagctgccgcatcgctgtgtgatcgacggggagatcatc
atcgccaccgaccacggcttggacttcgaggcgctgcaacagcgcatccatcctgccgag
tcgagggtgcgaatgcttgccgaccgcacaccagcctccttcatcgcattcgacctgctg
gccctcggcgacgacgactacaccgggcgaccgttcagcgaaagacgagccgctctggtc
gatgccgtaactggttcgggggccgacgctgacctgtcgatccacgtcaccccggcaacc
accgacatggcgaccgcacaacgatggttctccgagttcgagggggccggtctagacggt
gtcatcgccaaaccgccgcacatcacctatcaaccggacaaacgcgttatgttcaagatc
aaacacctgcggaccgccgattgcgtggtcgccggctaccgggtgcacaagtccggcagt
gacgcgatcggctcactgctgctagggctttaccaggaggacggccaactcgcgtcggtc
ggcgtgatcggcgcgttccccatggccgaacgacgccggctattaaccgagctgcagccg
ctggtcaccagcttcgacgaccacccatggaactgggccgcccacgttgccggccagcgc
accccacgtaagaacgagttctcccgctggaatgtcggcaaagacctgtcgttcgtgccg
ctgcgacccgagcgggtggtcgaggtccgctacgaccacatggaaggcgcgcggttccgc
cacaccgcacagttcaaccggtggcgccccgaccgcgacccacgctcatgcagctatgcc
cagctcgaacgcccgctcaccgtcagcctctccgacattgtgccgggcctacgctaa

DBGET integrated database retrieval system