KEGG   Medicago truncatula (barrel medic): MTR_0018s0260Help
Entry
MTR_0018s0260     CDS       T01716                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00020  Citrate cycle (TCA cycle)
mtr00190  Oxidative phosphorylation
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
mtr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MTR_0018s0260
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MTR_0018s0260
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MTR_0018s0260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 25479657
NCBI-ProteinID: XP_013443377
UniProt: A0A072TJ20
LinkDB All DBs
Position
Unknown
AA seq 278 aa AA seqDB search
MASTMLKRAINSISSSPTSRLTLLRAHASEAQAQQVSPKARDTTVLKKFQIYRWNPDTPS
KPELKEYEINLKECGPMVLDALIKIKNDIDPSLTFRRSCREGICGSCAMNIDGCNGLACL
TKIPDAGTDSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPAEEDGKEIRQSKK
DRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEAIN
DEFKLYRCHTILNCARACPKGLNPGKQIAHIKSLQPKA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaactatgctcaagagagcaatcaacagcatctcatcttccccaacctcccga
ctaaccctcctccgagcccatgcctccgaagcccaagcccaacaagtctcccccaaagcc
cgcgacaccaccgtcctaaaaaaattccaaatctaccgttggaaccccgacacaccttca
aagcccgaactcaaagaatacgaaatcaacctcaaagaatgtgggcccatggttctcgac
gctctaatcaaaataaaaaacgacatcgatccaagcttaaccttccgtcgttcctgccgc
gaaggaatctgcggctcatgcgcaatgaacatcgacggctgtaacggactggcttgttta
acgaagattccggatgcggggacggattcgacgataactccattgccgcatatgtttgtt
ataaaggatcttgtggttgatatgacgaatttttataatcagtataagagtattgagccg
tggttgaagaggaagagtccggcggaggaagatggaaaggagattaggcagagtaagaag
gatagggctaagcttgatgggatgtatgagtgtattttgtgtgcttgttgtagtacttct
tgtcctagttattggtggaatcctgagtcttatcttggtcctgctgctttgcttcatgct
aataggtggataagtgacagtcgtgacgagtacaccaaggagagattggaagctattaat
gatgaattcaagctctatcgttgccacactatattgaactgtgcacgtgcatgtccaaag
gggttaaatcctggaaagcaaattgcacatatcaagtcacttcagccaaaagcttga

DBGET integrated database retrieval system