KEGG   Medicago truncatula (barrel medic): MTR_1g019440Help
Entry
MTR_1g019440      CDS       T01716                                 

Definition
(RefSeq) alpha amylase domain protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00500  Starch and sucrose metabolism
mtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MTR_1g019440
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MTR_1g019440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70 Mtp
Motif
Other DBs
NCBI-GeneID: 11419190
NCBI-ProteinID: XP_003589186
UniProt: G7I3K2
LinkDB All DBs
Position
1
AA seq 421 aa AA seqDB search
MNSLPWLSLFCFCLSIFPLLASSTLLFQGFNWESSNKGGWYNSLKNLIPDLANAGITHVW
LPPPSQSVGPQGYLPGRLYDLDASKYGSKDDLKSLIAAFKDKGINCLADIVINHRTAERK
DDRGIYCLFEGGTPDSKLDWGPSFICKDDTAYSDGTGNLDSGEGYQAAPDIDHLNPQVQK
ELSEWMNWLKTEIGFSGWRFDFVKGYAPSITKIYMENTSPDFAVGEYWNSLSYGQDGKLN
YNQDAARGELVNWVENGGGVVNAFDFTTKGILQAAVQGELWRLKDSNGKPPGLIGIKPEN
GATFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKDQIAKLTAI
RQRNGINMKSTVNILAADADLYVAKIDNKIIVKIGPRMDLGNLIPSNFHVATSGQDYAVW
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaattctcttccttggctcagtcttttctgcttctgtctttctatttttcctctttta
gcttcttctactttgctctttcagggattcaactgggagtcaagtaacaaaggaggatgg
tacaactctttgaagaacctcattcctgacctagcaaatgctggaattacacatgtttgg
cttcctcctccatctcaaagtgttggtcctcaaggatatcttccaggaagactttatgat
cttgatgcatcaaaatacggttcaaaagatgacctaaagtcactaattgcagctttcaaa
gataaaggaatcaattgtctagctgacatagtgatcaaccatagaacagcagaaagaaaa
gatgatagaggcatctattgcctctttgaaggtgggactcctgattcaaaacttgattgg
ggcccatctttcatttgcaaagatgacactgcttattcagatggcactggaaacctcgat
agtggagagggctatcaagctgcacctgacattgatcatctcaatcctcaagtacaaaaa
gagttatctgaatggatgaattggctcaaaactgaaattggattttctggttggagattt
gattttgtcaaaggttatgcgcctagcataacaaaaatttatatggaaaatacttcgcca
gattttgccgtgggagaatattggaattcgctttcttacggacaagatggaaaactcaac
tataatcaagatgcagctagaggtgaacttgttaactgggttgaaaatggtggcggcgtt
gttaatgcatttgattttactaccaaaggtattcttcaagctgctgtacaaggggaactt
tggaggttgaaagattcaaatggaaaaccacctggtttgattggtataaaaccagaaaat
ggtgcaacatttattgataaccatgatacaggttcaactcagaaactttggccatttcct
tctgacaaagtcatgcagggttatgcttacattctaacacatcctggaacaccatcaata
ttctatgaccacttctttgattggggactgaaggatcagatagcaaaattgactgcaatt
agacagaggaatgggatcaacatgaaaagcacagtgaacattctagcagctgatgctgac
ctatatgtagcaaagatagacaacaagattattgtaaagataggaccaaggatggacctt
ggaaatcttattccctctaatttccatgttgctacatctggccaagactatgccgtgtgg
gagtga

DBGET integrated database retrieval system