KEGG   Medicago truncatula (barrel medic): MTR_1g050720Help
Entry
MTR_1g050720      CDS       T01716                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00564  Glycerophospholipid metabolism
mtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MTR_1g050720
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MTR_1g050720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Pyr_redox HI0933_like GIDA NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 11419875
NCBI-ProteinID: XP_003590261
UniProt: G7I7V6
LinkDB All DBs
Position
1
AA seq 626 aa AA seqDB search
MTRLRRLGTAIGVAAATAYGGAILLSPSYTSNDHGSQVAAFQQKIHDPNAVLPSRQVQQS
SLIGSTSANPLDILVIGGGATGTGVALDATTRGLRVGLVEREDFSSGTSSRSTKLVHGGV
RYLEKAVFKLDYGQLKLVFHALEERKQVIDNAPHLCNALPCMTPCFDWFEVVYYWMGLKM
YDLVAGARLLHLSRYYSTKESVELFPTLATEGKGRSLRGTVVYYDGQMNDARLNVGLACT
AALAGAAVLNHAEVVSLLKDGGGERIVGARIRDNLTGKEFDTYAKVIVNAAGPFCDSVRK
MADKNVRDVICPSSGVHIILPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTLAGTTDSNT
AITFLPEPHEDEIQFILDAISDYLNVKVRRSDVLSAWSGIRPLATDPSAKNTESISRDHV
VFEEHPGLVTVTGGKWTTYRSMAEDAVDVAIKAGKLTPVGGCVTNNLRIVGGEGWDPASF
TVLTQQYLRMKLTHGGKVVPGVMDTASAKHLSHAYGTLGERVAAIAQNENLGKRLAHGYP
FLEAEVAYCARHEYCESATDFIARRSRLAFLDTDAARRALPRVIQLMAAEHKWDKSRQKE
ELQKAKDFLETFKSSKNAQFYDGKHN
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcctgagacgactcggcaccgccatcggagtagctgcagccactgcttacggc
ggcgcgatcctgctctcaccttcatatacatccaacgatcatggatcccaggtcgcagct
ttccaacagaagatccacgacccaaacgccgtcctcccgtccagacaagttcagcagtcg
tcactcattggctccacctccgctaacccgctcgacattctcgtaattggcggaggagcc
accggtaccggcgttgccctggatgccaccacacgtggactccgtgtcggcctcgttgaa
agagaggatttctcatctggaacttcttctcgctccactaaactcgtacatggaggtgtt
cgttacttggagaaagctgtcttcaaacttgactatggccaactcaagttagtattccat
gcacttgaggagcgcaagcaggttatcgacaatgcaccacatctatgcaatgctttacct
tgcatgaccccatgttttgattggtttgaagtagtgtactactggatgggcttgaaaatg
tacgatctggtagctggagcacggcttttgcatttatcaagatattattctacaaaagag
tctgttgagctctttcctactttggcaacggaggggaaaggtagaagcttgaggggcaca
gttgtttattacgatggccagatgaatgatgcaaggcttaatgttgggttggcttgcaca
gctgcattggctggtgcagcagtcctaaaccatgctgaagttgtatccctattgaaggat
ggtggtggtgaacgaatagttggtgcacgaattagggacaacttaactggcaaagagttt
gatacatatgcaaaagtgattgtgaatgcagccggcccgttttgtgattctgtaaggaaa
atggctgacaaaaacgtacgagatgtgatttgtccgagtagtggtgtacatattatactc
cctgattattattctcctgaaggaatgggcttaattgttcctaaaactaaggatgggcgc
gttgtttttatgctgccttggctgggaagaactcttgctggaactacagattccaacact
gccattacttttcttccagaaccacatgaagatgaaatacaatttatattggatgccata
tctgactaccttaatgttaaggtcagacgctctgatgttctttctgcttggagtggcatt
cgaccactagcaacagacccatcagctaaaaatacggaaagcatctccagggatcatgtt
gtctttgaagagcaccctggtctggtcaccgtcactggtggcaagtggaccacctatcgc
agcatggctgaagatgctgttgatgtagctataaaggcagggaaactgacccccgtcggt
ggatgcgtgaccaataaccttaggattgttggtggcgaagggtgggatcctgcttctttt
acagttctcacgcaacagtatttgcgcatgaaactaacacatgggggaaaagttgttcct
ggggtaatggacactgcatcagcaaaacacttgtctcatgcatatggaacattgggtgaa
cgtgtggccgccattgctcagaatgaaaatttgggtaagcggcttgctcatggttaccct
tttttggaggctgaggtggcttactgtgctcgtcatgaatattgtgaatctgccactgac
ttcattgcaaggaggtctcgacttgctttccttgacactgatgcagcaagacgggcatta
cctcgtgtgattcaattaatggcagctgaacataaatgggacaaatcaaggcagaaggaa
gagctgcagaaggctaaagattttttggagacttttaaatcctccaaaaatgcccagttc
tatgatgggaaacacaattag

DBGET integrated database retrieval system