KEGG   Medicago truncatula (barrel medic): MTR_1g111140Help
Entry
MTR_1g111140      CDS       T01716                                 

Definition
(RefSeq) 2-oxoacid dehydrogenase acyltransferase family protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00010  Glycolysis / Gluconeogenesis
mtr00020  Citrate cycle (TCA cycle)
mtr00620  Pyruvate metabolism
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
mtr01200  Carbon metabolism
Module
mtr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_1g111140
   00020 Citrate cycle (TCA cycle)
    MTR_1g111140
   00620 Pyruvate metabolism
    MTR_1g111140
Enzymes [BR:mtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MTR_1g111140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DciA GCV_H
Motif
Other DBs
NCBI-GeneID: 25485515
NCBI-ProteinID: XP_013470199
UniProt: A0A072VR15
LinkDB All DBs
Position
1
AA seq 470 aa AA seqDB search
MNTHSLSSSMISMSSSSSIRTPQFTTLLLPHRSSPRRKSFSFKIQAKIREIFMPALSSTM
TEGKIVSWIKSEGDTLSKGDSVVVVESDKADMDVETFYDGILAAIVVDEGETAPVGAPIG
LLAETAEDIAEAQAQAKSVKSASSSSSSPPQETSQSPPPPPPPAAVKSVSDGPKKITATP
QAKKLAKQHKVDIASVNGTGPFGRITPADVEAAAGITPVKSNVAPVATPTPVAPKGGSSA
AAPAAIPGSSNVAFTTMQSAVAKNMMESLSVPTFRVGYPVITDALDAFYEKVKPKGVTMT
AILAKAVAMALVQHPVVNATCKDGKNFHYNSNINVAVAVAINGGLITPVLQNADKLDLYL
LSQKWKELVGKARSKQLQPNEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPT
VLADADGFFRVKSKMLVNVTADHRIIYGADLAAFLQTFSKIIENPESLTL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacattctctctcttcttcgatgatctcaatgtcttcttcatcttctattcgc
acccctcaattcaccactctcctcctcccccaccgctcctcccctcgccgcaaatccttt
tccttcaaaatccaagctaagatccgtgaaatcttcatgcctgcactcagttccactatg
accgagggtaaaatcgtctcctggatcaaatccgaaggcgacactctctccaaaggtgac
agtgtcgttgttgttgaatctgataaagctgacatggacgttgaaactttctacgacgga
attctcgctgctatcgttgtcgacgagggagaaaccgctcccgttggtgctcctattggt
ttactcgctgaaactgctgaagatattgctgaagctcaagcccaggctaaatccgtcaaa
tccgcttcttcttcctcttcctctcctcctcaggaaacttcgcagtctcctcctccacca
cctccacctgcggcggttaagtctgtttccgatggtcccaagaaaatcacagcgacacct
caagcgaagaagcttgcgaagcagcataaggtggacattgcttctgtaaacgggactggt
ccgtttggtaggattactcctgcggatgtagaggctgctgctgggattacaccggtgaag
agtaatgtagctccggtggcaacccctactccggttgcaccgaaaggtggttcttctgct
gctgcaccagctgcgattccgggttcgagtaatgttgctttcacaactatgcaatctgct
gttgctaagaatatgatggagagtttatcggttcctactttccgtgttgggtatccagtt
atcactgatgcacttgatgctttctatgagaaggtgaaacctaagggcgtgactatgact
gctattttggctaaggctgttgcaatggcacttgttcagcatccagttgtcaatgccacc
tgcaaagatggcaagaactttcattacaacagtaacattaacgttgcagttgctgtggca
atcaatggtggcttgataaccccagttcttcaaaatgctgataagttggacttgtatctg
ctgtctcaaaagtggaaagaactagttggaaaggctcgttcaaagcaattgcaaccgaat
gagtataattcaggaactttcacgctttccaatttgggtatgtttggagttgacagattt
gatgccatacttccaccaggccagggggctatcatggctgttggagcatcaaagcccact
gttcttgctgatgcagatggattcttcagagtgaaaagtaaaatgctggtgaatgtaaca
gctgatcaccgaataatttatggagctgacttggctgccttccttcagacattctctaaa
atcattgaaaacccagaaagcctaacattatag

DBGET integrated database retrieval system