KEGG   Medicago truncatula (barrel medic): MTR_1g116080Help
Entry
MTR_1g116080      CDS       T01716                                 

Definition
(GenBank) carbon-nitrogen family hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MTR_1g116080
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     MTR_1g116080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AES63039
UniProt: G7IF23
LinkDB All DBs
Position
1
AA seq 321 aa AA seqDB search
MRLSSCWVNNNIRINNTNGTSIRRRLRASLSVTTGESTMATNSVRVAAAQMTSITDLASN
FSTCSRLVKEAASAGAKLLCFPEAFSFVGAKDGDSVSIAQPLDGPIMDQYCSLARESSIW
LSLGGFQEKGSDPRHLFNTHVVVDDTGKIQTTYRKIHLFDVDVPGGRVYKESNFTESGKD
IVAVDSPIGRLGLSVCYDLRFPELYQLLRFQHGAQILLVPAAFTKVTGEAHWEILLRARA
IENQCYVIAAAQAGTHNDKRESYGDTLIIDPWGTVVGRLPDRLSTGIVVADIDLSLVDSV
REKMPIAKQRKPFDFWKAASL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgtcgtcatgttgggtgaataataatattagaatcaataacactaacggtact
tccattcgccgccgattacgagcctctctctccgtcaccaccggcgagtcaaccatggcc
actaattcagtccgagttgccgcagctcaaatgacatccatcaccgacctcgcttccaat
ttctccacctgctctcgtcttgtgaaagaagctgcatcagctggagcaaaattgctttgt
tttcctgaagcattctcttttgtgggtgctaaggatggtgatagtgttagtattgctcaa
cctttggatggacctattatggaccaatactgctctttagccagagagtcaagtatttgg
ttgtcacttggtggctttcaagaaaaaggatctgatcctcgacatttgtttaatacacat
gttgttgtagatgacactgggaaaattcaaaccacttatagaaaaatacacctgtttgat
gtggatgttcctggtggaagggtatataaagaaagtaattttacagaatcaggcaaggat
attgttgcagtagacagtcctattgggcgtttgggccttagtgtttgctatgatttgaga
tttcctgagctttatcagttgttgcgtttccaacatggagcacagatactattggtgcct
gcagcattcactaaagtgactggtgaagcacactgggagattcttcttcgtgctcgtgca
atcgagaatcaatgctatgtcatagctgctgcgcaagctggcacacacaatgacaaaaga
gaaagttatggtgacacattgattatcgatccatgggggaccgttgttggtcgcttacca
gatcgtttgtccacgggaattgtggtagctgatattgatttatcattagttgattcagta
agagagaagatgcctattgctaagcaaaggaagccatttgacttctggaaagctgcttct
ctatag

DBGET integrated database retrieval system