KEGG   Medicago truncatula (barrel medic): MTR_3g062560Help
Entry
MTR_3g062560      CDS       T01716                                 

Definition
(GenBank) hypothetical protein
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00310  Lysine degradation
mtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    MTR_3g062560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mtr03036]
    MTR_3g062560
Enzymes [BR:mtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     MTR_3g062560
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     MTR_3g062560
Chromosome and associated proteins [BR:mtr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MTR_3g062560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-ProteinID: AES70804
UniProt: G7IV53
LinkDB All DBs
Position
3
AA seq 200 aa AA seqDB search
MEREKGRERIRPSYLAETAPPPIPNPNNYCSTSHSSIPLSSAEHHLPSSSTSSLLRTALR
LLHRHSHGSTRLNHLLTNRHLLTSQNDDVAETVRLGAVIMAAAIEKQNGCSYDGAAILEE
ATVALCAVLTNAVEVHDNEGCALGIAVFEHAFSWINHSCSPNACYRFSFSTSSLLPHQSE
LRIAPFTQNSKSLLFFIYFF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggagagagaaaaaggaagagagaggataagaccatcatacttggcagaaactgcccca
cctcccattcccaatcccaataattactgttccacctcccattcctcaatccctctctcc
tccgccgaacaccacctcccttcctcctccacctcctccctcctccgcaccgccctccgt
ctcctccaccgtcactcccatggctccactcgcctcaatcacttactcaccaaccgtcat
ttactcacatctcaaaatgacgacgtggcagaaactgtccgcctcggcgcagttatcatg
gccgccgcaatagaaaagcagaacggttgcagctacgacggtgcagcaattctggaggaa
gccacagttgctctctgtgcagtgctaaccaacgccgtggaggtgcatgataacgaagga
tgcgcactcgggattgcggtttttgaacatgctttctcttggattaatcatagttgttcc
cctaatgcttgctaccgattctccttctccacttcttctttgcttcctcatcaatccgaa
cttcgcatagctccattcactcaaaattctaagtctcttttgttttttatttattttttt
taa

DBGET integrated database retrieval system