KEGG   Medicago truncatula (barrel medic): MTR_3g064740Help
Entry
MTR_3g064740      CDS       T01716                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00250  Alanine, aspartate and glutamate metabolism
mtr00410  beta-Alanine metabolism
mtr00430  Taurine and hypotaurine metabolism
mtr00650  Butanoate metabolism
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
Module
mtr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MTR_3g064740
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MTR_3g064740
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MTR_3g064740
   00430 Taurine and hypotaurine metabolism
    MTR_3g064740
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MTR_3g064740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 11408278
NCBI-ProteinID: XP_003600653
UniProt: G7J8M7
LinkDB All DBs
Position
3
AA seq 508 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRTSLPRFKMPEESIPKDAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEENEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKQEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPAKAVELVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWAIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNVMENCRDNMIVLKEGLEK
MGRFNIVSKDDGVPLVAFTLKDPHNFDEFQISDLLRRFGWIVPAYSMPPDAQHITVLRVV
IREDFSRTLAERLVADIEKVLHELDSLTAKIKMLSGTSSVTVHEVVKDNGQVVVAKKSAL
ETQREITAIWKKFVLDRKKLNDKMNGVC
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggttctctcaaagacagcctccgagtctgatgtctctgtccactcaacctttgcttct
cgctatgtcagaacttcacttcctagattcaagatgccagaggagtctataccaaaggat
gcagcataccaaataataaacgatgaattgatgcttgatggaaaccctagattgaatttg
gcatcctttgtgacaacatggatggagcctgagtgtgataaactcatcatggcttccatt
aacaagaactacgttgacatggatgaatacccagtcaccactgagctacagaatcggtgt
gttaacatgatagctcatcttttcaatgcaccacttgaagagaatgaggctgcagttggt
gttggcactgttggctcatcagaggctataatgttagctggattggcattcaaaaggaag
tggcagaacaaaagaaaacaagagggaaagccttatgacaaacctaacattgtcactgga
gccaatgtccaggtttgttgggagaaatttgcaaggtactttgaagtggaattgaaagag
gtgaagctaagtgaaggatactatgtaatggaccctgcaaaagctgtggaattggtagat
gagaacaccatttgtgttgctgctatccttggttccacactaaatggagagttcgaagat
gttaaacgcttaaacgatctccttgttgaaaagaataaggaaactggatgggacactcct
attcatgtggatgcagctagtggtggcttcattgctccatttatttatccagaacttgag
tgggatttccgcttaccattggtgaagagcatcaatgttagtggtcacaaatatggtctt
gtctatgctggaattggttgggctatttggagaagcaaggaagatttgcctgaagaactc
atctttcacatcaactatctaggagctgatcaacctacctttactctcaacttctccaaa
ggttctagccaagtcattgctcaatactaccaactaatacgtcttggttatgaggggtat
aaaaatgtgatggagaattgtagagacaacatgatagtactaaaagagggacttgaaaaa
atggggcgcttcaacatagtgtcgaaagacgacggtgtacctttggtggccttcacattg
aaggacccacacaactttgatgaatttcaaatctccgatttgttgaggcgcttcggatgg
attgttccagcatacagcatgcccccggatgcgcaacacataaccgttttacgcgttgtc
attagggaggatttctcaaggactttagcagagcgccttgtagctgatatagagaaagtg
ttgcacgagcttgattcacttactgcgaagataaagatgttaagtggcactagtagtgtt
acagttcatgaagttgtgaaagacaatggtcaagtagtggttgctaaaaagagtgctttg
gagactcagagagaaattactgcgatttggaagaagtttgtgttggataggaagaagctg
aatgataagatgaatggtgtttgctag

DBGET integrated database retrieval system