KEGG   Medicago truncatula (barrel medic): MTR_4g107040Help
Entry
MTR_4g107040      CDS       T01716                                 

Definition
(RefSeq) NAD-dependent aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00010  Glycolysis / Gluconeogenesis
mtr00053  Ascorbate and aldarate metabolism
mtr00071  Fatty acid degradation
mtr00280  Valine, leucine and isoleucine degradation
mtr00310  Lysine degradation
mtr00330  Arginine and proline metabolism
mtr00340  Histidine metabolism
mtr00380  Tryptophan metabolism
mtr00410  beta-Alanine metabolism
mtr00561  Glycerolipid metabolism
mtr00620  Pyruvate metabolism
mtr00903  Limonene and pinene degradation
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_4g107040
   00053 Ascorbate and aldarate metabolism
    MTR_4g107040
   00620 Pyruvate metabolism
    MTR_4g107040
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MTR_4g107040
   00561 Glycerolipid metabolism
    MTR_4g107040
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MTR_4g107040
   00310 Lysine degradation
    MTR_4g107040
   00330 Arginine and proline metabolism
    MTR_4g107040
   00340 Histidine metabolism
    MTR_4g107040
   00380 Tryptophan metabolism
    MTR_4g107040
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MTR_4g107040
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MTR_4g107040
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MTR_4g107040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 11443205
NCBI-ProteinID: XP_003608978
UniProt: G7JPU6
LinkDB All DBs
Position
4
AA seq 544 aa AA seqDB search
MAARTLSRLLSRSLSSSSSSSGASASLLRSPLGRKSEGLINTNRFSTAAAVQELITPQVS
INYTQHLINGKFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVSAAREAFDNGPWP
KMSAYERCRILLRFADLVEKHNDEIAALEAWNNGKLYEQAAKAEVPMFVRLFRYYAGWAD
KIHGLTVPADGDYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQT
PLTALLVAKLLHEAGLPPGVLNIVSGYGPTAGASLASHMDVDKLAFTGSTDTGKTVLELA
ARSNLKPVTLELGGKSPFIVFEEADIDKVVEIAHFALFFNQGQCCCAGSRTFVHERIYDE
FLEKSKERALRRVVGDPFKKGVEQGPQIDSKQFEKVLRYIKSGIDSNATLECGGGRLGSK
GFFVQPTVFSNVQDDMLIAKDEIFGPVQTILKFKDINEVIRRANATRYGLAAGVFTNNVS
TANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLNN
PAWL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcgcacactttctcgtttgctctctcgctccctatcttcttcttcttcttct
tctggagcttctgcttctctgcttcgctcaccgcttggaagaaaatctgaagggttgata
aacacaaacagatttagcactgctgcagctgttcaggaattgattactccacaagtttca
ataaattatacacagcatcttataaatggaaagtttgtggatgctgcatcagggaaaaca
tttccaacacttgatccacgcacaggggaagtgattgctcatgttgctgaaggtgatgct
gaagatattaaccgtgcagtttcagcagctcgtgaggcctttgataatggaccttggcct
aaaatgagtgcttatgaaagatgtcgtatattgttgcgatttgctgatttggttgagaag
cacaatgatgagattgcagctctggaggcatggaacaatggaaagctttatgaacaggct
gccaaagctgaagtacctatgtttgtgcgtttatttcgctactatgctggttgggcagat
aaaattcatgggctgacagtcccggctgatggagattatcatgtccagacattgcatgaa
ccaattggtgtagcaggacaaattataccttggaattttcctctacttatgtttgcttgg
aaagttggaccagctctagcatgtggtaataccattgtcctcaagactgctgagcaaaca
ccgctaacggctctacttgtggcaaaactacttcatgaggccggtctacccccaggtgtt
ctgaatatagtttctggctatggtccaactgctggtgcatctcttgcaagtcatatggac
gtggacaagttagcgttcactggatcaacagacactggaaaaactgtacttgagctggct
gcaagaagcaatcttaagccagtgacattagaacttggagggaaatcgcctttcattgtc
tttgaggaagctgatattgacaaggttgttgaaattgctcactttgctcttttctttaat
cagggacaatgttgctgtgctggatcccgtaccttcgtacatgagcgtatctatgacgag
ttcttggagaaatcaaaggaacgagctttgagacgtgttgttggtgatccatttaagaag
ggtgtagagcaaggtcctcagattgattcgaaacaatttgagaaagtacttaggtatata
aagtctggaattgatagcaatgctacacttgaatgtggaggtgggagattgggttccaaa
ggcttctttgtccagccaactgtattttcaaatgttcaggatgatatgttgatagctaaa
gatgaaatatttggcccagttcagaccatcttgaagttcaaggacattaatgaagtgata
cgacgggcaaatgcgacacgttatggtttagcagcaggtgttttcacaaacaacgtgagc
acagccaacactttgatgcgggcactgagagctggaacagtgtggattaattgctttgat
gtgtttgatgctgcaattccttttggtggttacaagatgagtgggattggcagggagaaa
ggaatatacagtcttcacaactatctgcaggtaaaagctgtggtgtccccactaaacaat
cctgcgtggttgtaa

DBGET integrated database retrieval system