KEGG   Medicago truncatula (barrel medic): MTR_5g016550Help
Entry
MTR_5g016550      CDS       T01716                                 

Definition
(RefSeq) phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00562  Inositol phosphate metabolism
mtr01100  Metabolic pathways
mtr04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MTR_5g016550
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    MTR_5g016550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mtr01009]
    MTR_5g016550
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     MTR_5g016550
    3.1.3.48  protein-tyrosine-phosphatase
     MTR_5g016550
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     MTR_5g016550
Protein phosphatases and associated proteins [BR:mtr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    MTR_5g016550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase PTEN_C2 Y_phosphatase3 CDKN3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 11406280
NCBI-ProteinID: XP_003611670
UniProt: G7K591
LinkDB All DBs
Position
5
AA seq 592 aa AA seqDB search
MEPAPPSSKTEPYSAKVPAENDNARDSPSLSPVSSISSWARNLRFGAADQNSQTENNGMS
AFARLTSGIGLRSPPNELATSSSGAEQPNIIESFTKGLVDSSKEAVKAVQTKARHIVSQN
KRRYQEGGFDLDMTYITENIIAMGFPGGDFSSGIFGYIEGFYRNHMEEVIKFFETHHKGK
YKVYNLCSERLYDGSLFQGKVASFPFSDHNCPPIQLIASFCRSAYSWLKEDIQNVVVVHC
KAGMGRTGLMICSLLLYLKFFPTAEEAIDSFNQKRCVDGKALTLPSQIRYVKYFERTLTH
FNGEVQPGRRCMLRGFRLHKCPYWVRPSITISDHNGILFTTRKHPKTKDLMPEDFWINAS
KKGILVFALPGEPGLTELVGDFKIHFHDRQGDFYCWMNTTMIENRKILDGSDLDDFDKRK
IPAPGFQVEVVMVDYDGTLPGKVNPASKGSDIRNVSSGAKPTSSSRKSKIPKNGDDDVFS
DSDEEETKGTQRREAATDYKYMEPHQASEATTDHVGMLSRATDQLSLQQHDERTENNVSE
ASTTNKHHNIHAGPNTTNMESIGTSEFKAIAADASVFSFGDEDFESDSEEAS
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggaacccgctcctccatcttcgaagactgaaccttactccgccaaagtacctgctgaa
aatgacaatgcacgtgattcaccatccttgtcaccagtttctagcatatcttcctgggcg
agaaatctgaggtttggggctgcagatcagaactcacagacagagaacaatggcatgtca
gcatttgctcgtcttactagtgggattggactacgaagtcccccaaatgagcttgctacg
agcagttcaggagccgagcaacctaatataattgaatcattcactaaagggttggtggac
tcttcaaaggaagcagtaaaggcagtgcagaccaaagcacgacatattgtttctcaaaat
aaacgcagataccaggaaggtggatttgatttggatatgacatacatcactgaaaatata
atagctatgggatttcctggtggtgattttagctctggaatttttgggtacattgagggg
ttctatcgaaatcacatggaagaagtaatcaagttttttgaaactcatcacaagggaaag
tacaaagtatacaatctttgttcagagaggttgtacgatggatcacttttccaggggaag
gttgcaagtttcccatttagtgatcataattgccctcctattcaacttatagcatcattt
tgtcgaagtgcatattcatggttgaaggaggatatccaaaatgtggtcgttgttcattgt
aaagctggtatgggaaggacaggactgatgatttgtagccttcttttgtatcttaagttt
ttccccactgctgaggaagccattgattcctttaaccagaaaagatgtgtagatggaaag
gctctaactctcccaagtcaaattagatatgtcaaatattttgaacggaccttaacacac
ttcaacggagaagtccagcccggacgaaggtgtatgctgagagggtttcggcttcacaaa
tgcccttattgggttagaccatccattacaatttctgatcataacggaattcttttcaca
actagaaagcatcccaagacaaaggatctaatgccagaagatttttggatcaatgcatca
aagaaaggaattttggtctttgcattaccaggggagccaggtctgacagaattggttggg
gacttcaaaattcattttcatgatcgacagggagatttctactgttggatgaatacaaca
atgatagagaacagaaaaattttagatggctcagatcttgatgattttgacaagagaaag
atcccagctccagggttccaggtcgaagttgtgatggtagactatgatggcacgctacct
ggaaaagtcaaccctgcaagcaaaggatctgacataagaaatgtctcatctggtgcaaag
ccaacatctagttcaagaaagagtaagatacctaaaaatggagatgatgatgtattctca
gatagcgatgaagaggagaccaagggaacacaaaggagggaagctgcaactgattacaaa
tatatggaacctcatcaagcatctgaggccactactgaccatgtagggatgttgtcgcgt
gcaacggatcagttgtcactccagcagcatgacgaacgcacggaaaacaatgtttctgaa
gcatcaactaccaataaacatcataatattcatgcaggtcctaacaccaccaacatggaa
tctatagggacaagtgaattcaaggcaattgcagcagatgcttcagttttttcttttgga
gatgaagattttgagagtgattcagaggaggcgagttaa

DBGET integrated database retrieval system