KEGG   Medicago truncatula (barrel medic): MTR_5g020050Help
Entry
MTR_5g020050      CDS       T01716                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00020  Citrate cycle (TCA cycle)
mtr00190  Oxidative phosphorylation
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
mtr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MTR_5g020050
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MTR_5g020050
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MTR_5g020050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 11405633
NCBI-ProteinID: XP_003611986
UniProt: G7KDJ3
LinkDB All DBs
Position
5
AA seq 626 aa AA seqDB search
MWRCVARGLRVPRSSNRSNNSLGSRLSRFFSSESYTVVDHKYDAVVVGAGGAGLRAAIGL
SEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQ
YMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLNFGKGGQAYRCACAADRTGHAL
LHTLYGQAMRHNTQFFVEYFALDLIMNSDGSCQGVIALNMEDGTLHRFQAASTILATGGY
GRAYFSATSAHTCTGDGNAMAARAGIGLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILR
NSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLHLNHLPPDVLKER
LPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDALVPGLMAA
GEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDAGQKTIAWLDK
LRNSNGSLPTSKIRLNMQKVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKVEDRSLIW
NSDLIETIELENLLINACVTMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGFWENEKV
RLDYRPVHLNTLDDEVESFPPKARVY
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgttgcgtcgctcgtggacttcgcgttccacgttcttctaacagatccaataac
tctctcggatctcgtctttctagattcttctccagtgagtcttacaccgtcgtggatcat
aaatatgatgcagttgtggtaggtgctggtggtgctggattaagagctgctattggactt
tctgaacatggattcaatactgcttgtattaccaagcttttcccaactcgttcacacact
gttgcagctcagggtggcataaatgctgcattgggaaatatgactgaagatgactggagg
tggcacatgtacgacactgtcaaaggaagtgattggctaggagatcaggatgccatccaa
tatatgtgtagggaagcaccaaaagcggttattgaactagagaattatggattgcctttt
tctcgaacagaggatggaagaatatatcaacgtgcatttggtggtcagagcttaaacttt
ggaaaaggtggtcaagcttaccgttgtgcatgcgctgctgatcgaactgggcatgcttta
ttgcacactctctatggccaggctatgagacacaatacacagttttttgtggaatatttt
gccttagatcttataatgaatagtgatggtagttgccaaggtgtaattgccttaaacatg
gaggatggaacactgcatcgtttccaagctgcttcaacaattttggccactgggggttat
ggtagagcatacttctcagcaacttcagcacatacatgcaccggagatggcaatgccatg
gctgcccgtgctgggatcggacttgaggatttagagtttgtgcaatttcacccaacgggt
atatatggagcaggttgccttataacagaaggttctcgtggtgaaggtggaattcttagg
aatagcgagggggagcggtttatggaacgatatgctcctacagcaaaggatcttgcatcc
agagatgtagtttcaagatcgatgactatggagatccgggaaggacgtggtgtaggaccc
gagaaagatcacatctatctacacttgaatcatctacctccagatgtgctcaaggagaga
cttcctggtatctctgaaactgctgctatttttgctggtgtggatgttacaaaggaaccc
attcctgttttgccaactgtgcattataacatgggtggcattcccacaaatcatcatgga
gaggtggttaccattaaaggagacgatccagatgcattagttcctggattgatggctgct
ggggaagcagcctgtgcatcggttcatggcgccaacagacttggtgcaaattcacttttg
gatattgttgttttcggtagagcttgtgcaaatagagttgcagaaattcataagccagga
gagaaacaaaagccattagagaaggatgctggccagaaaacgattgcatggctggacaaa
ttgagaaattctaatggttcattgcctacttcaaaaattcggttgaatatgcaaaaagta
atgcaaaataatgctgctgtattccgtacacaagaaacattagaagaaggttgtcaatta
attgataaaacgtgggagagtttccatgatgtcaaggttgaagacagaagtttgatatgg
aactccgatttgattgagactattgagttggaaaatcttttgataaatgcctgcgtcaca
atgcactctgcagaagctaggaaagagagtagaggagctcatgcccgtgaggacttcacg
acaagagatgatgagaagtggatgaaacacactttgggattctgggagaacgagaaagtc
cgattggattacaggcctgtgcatttgaatacattggatgatgaggttgaatcattccct
cctaaggctcgtgtgtattaa

DBGET integrated database retrieval system