KEGG   Medicago truncatula (barrel medic): MTR_6g009410Help
Entry
MTR_6g009410      CDS       T01716                                 

Definition
(RefSeq) plant/F14N23-31 protein
Organism
mtr  Medicago truncatula (barrel medic)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1336
Motif
Other DBs
NCBI-GeneID: 11425332
NCBI-ProteinID: XP_003618427
UniProt: G7KK06
LinkDB All DBs
Position
6
AA seq 442 aa AA seqDB search
MGGCASKPKVNDDGVKMKRMNCHNHRRKRRRILRRRVSSHKIESNLGHSNSALQASNRAS
DAAWFDSTSALDSECDDEFYSVYDGEISATHADENGEERILTLTPDHCGILPNNCLPCLS
SSNPPVVEKKRPSSPDTPSSRRKSLSKLSFKWREGPSDMALLSPRAFKQKLVAGSTIPFC
PIEKQTPGSWSPLEPSSFRVRGKNYLRDKKKEFAPSGAAFYPLGADLFLSPRKVDHIARY
VQIPAINVPGDVPSILVVNIQIPLYTASIFQSENDGEGMNVVLYFKLSEKYSKDLSEQFR
ENITKMINDEVERVKGFPMDSIAPFRDRLKILGRVVNVDNLNLSATEKKLMNAYNEKPVL
SRPQHEFYLGENYLEIDIDVHRFSYIARKGFEGFIERLKLCNLDFGLTIQGNKPEDLPEH
LLCAIRLNKIDHSTFNQIGLLS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgggtggttgtgcttctaaacctaaagtaaatgatgatggtgttaaaatgaagagaatg
aattgtcataatcatagaagaaaaagaagaagaattcttagaagaagagtttcttctcat
aagattgaatcaaatcttggtcactctaattctgctttacaagcttctaatcgtgcttca
gatgctgcttggtttgattctacttcagcgttggattctgaatgtgatgatgagttttat
agtgtttatgatggagaaatttctgcaactcatgctgatgagaacggagaggaaagaata
ctaaccctaacccctgatcattgtgggattctgccaaacaactgtttgccttgcctttct
tcttctaatccccctgttgtcgagaagaaacggccatcgagtcctgacacaccgagttca
agaagaaagtcgctttctaaactgtcattcaagtggagggaagggccttctgacatggca
ttactttcccccagggcattcaaacaaaaactagtagcaggttcgaccattccattttgt
ccgatagagaaacaaacccctggttcttggtcaccacttgagccaagttccttcagagtc
agaggaaagaattacttgagggataagaagaaagagtttgctccaagcggtgctgctttc
tatccccttggtgctgacctctttttgtctccacgaaaagttgaccatattgcccgctat
gtacaaattcctgcaataaatgtacctggggatgtcccttctattcttgttgtaaatatt
cagataccgttatatactgcctcaatcttccaaagtgaaaatgatggcgaaggaatgaat
gtggttttgtacttcaaattatctgaaaaatattctaaagatctttcggaacaatttcga
gaaaatatcactaaaatgataaacgatgaagtggagagagttaaaggcttccctatggat
tcgatcgcaccctttagagatagattaaaaatcttaggtagagtggtgaatgtggacaat
cttaatttaagcgcaacagagaagaagttgatgaatgcttacaatgaaaaacctgttctc
tcacgtcctcagcatgagttttacttgggagaaaactatcttgagatagatatagatgtg
cacagatttagctatattgcaaggaaaggatttgaaggcttcatagaaagactgaagcta
tgtaaccttgattttggtctgacaattcagggaaacaagccagaggacttgccagagcat
ttattatgtgcaattcggttgaataaaattgaccacagcactttcaaccagattggtctt
ttaagttga

DBGET integrated database retrieval system