KEGG   Medicago truncatula (barrel medic): MTR_7g012250Help
Entry
MTR_7g012250      CDS       T01716                                 

Definition
(RefSeq) calcium/lipid-binding (CaLB) phosphatase
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00562  Inositol phosphate metabolism
mtr01100  Metabolic pathways
mtr04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MTR_7g012250
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    MTR_7g012250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mtr01009]
    MTR_7g012250
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     MTR_7g012250
    3.1.3.48  protein-tyrosine-phosphatase
     MTR_7g012250
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     MTR_7g012250
Protein phosphatases and associated proteins [BR:mtr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    MTR_7g012250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 Y_phosphatase PTPlike_phytase CDKN3
Motif
Other DBs
NCBI-GeneID: 11414188
NCBI-ProteinID: XP_003621351
UniProt: G7L452
LinkDB All DBs
Position
7
AA seq 420 aa AA seqDB search
MGLKLTKQGSPPKISSPASLQLHERMIHYLTKNFIRNLVSKQRRRILIAGYDLDMSYITD
RVLAMSFPAERMRAMYRNPLWQVKSVLDMRHLEHYKVYNLCIEEHYDPAQFYGRVEEYPF
DDNHVPSLEMIKDFCESVNSWLTRDPKNIVVIHCMAGKGRTGLMVSSYLTYCGMSADEAL
QLYADRRTTNNEGVSIPSQRRYVGYWESLLSVPRGAGYGPPKVTLPQPCSRELRRVRLYD
TVNIDTVFFVISELQEIPNEVYRPSVEVCRSCCREVKKGYQRTNSPRYYISTIPQGDEDG
EQSEIEEPRVVVQMDTESPAIYQKSCLDHYFDKPIQVTGDVRVIFYEKMIGGRLFYCCFN
TAFIRNSLLQLTVNELDKVGKKGRSICGPTFCLELLFGPANTGYSSSSISIGENSSDDSL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggggttgaaattaacaaagcagggttcaccacccaaaattagtagtccagcaagtttg
caattacatgaaagaatgattcattaccttaccaagaattttatccgtaacttggtatcc
aagcaaaggagaagaattcttatcgctggttatgatcttgatatgtcatatatcacagat
agagtattagcaatgtcatttcctgctgaacgtatgagagcaatgtatagaaatcctctc
tggcaagtcaaatctgtgttggatatgagacatcttgaacattataaggtctataatctg
tgtatagaagaacattatgatccagcacagttctatggtcgtgtggaagaataccctttt
gatgacaatcatgttccatctcttgaaatgattaaagatttctgcgaaagtgtgaattca
tggctgacacgtgacccaaaaaatattgtagttatacattgcatggcaggtaaaggtaga
actggtttgatggtgagttcatacctaacttattgcggcatgtcagcagatgaagctctt
caattatatgccgacagaaggactaccaataatgaaggagtatcaataccaagccaacgt
cgctatgtagggtactgggaaagtttactttctgtacctagaggtgctggatatggacct
ccaaaggtgactttgcctcaaccgtgtagcagagaattgcggcgagtccggttgtatgac
actgtcaacattgacacagtattctttgttatatcagaactgcaggagattcctaatgag
gtctatcgtccatcagtggaggtttgtcggagctgctgtagagaagttaagaaaggttat
cagagaacaaacagtcctcgctattatatttctactattcctcaaggtgatgaagatgga
gaacaatcagaaatagaagaacctcgtgttgtagttcaaatggatacagagtctcctgca
atataccagaaatcttgtttggaccattattttgataaacctatacaagtaaccggagat
gtacgtgtgatattctacgagaaaatgattggaggacgtcttttctactgctgctttaat
acagcttttattaggaacagcttactacagctcacagtaaatgaattggacaaagttggg
aagaaaggaagatcaatatgtggccctactttctgcctggaattattgtttggtcctgct
aatacagggtattcatcatcaagtatatctattggtgaaaactctagtgatgattcatta
taa

DBGET integrated database retrieval system