KEGG   Medicago truncatula (barrel medic): MTR_7g021770Help
Entry
MTR_7g021770      CDS       T01716                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase large chain domain protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00630  Glyoxylate and dicarboxylate metabolism
mtr00710  Carbon fixation in photosynthetic organisms
mtr01100  Metabolic pathways
mtr01200  Carbon metabolism
Module
mtr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mtr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
mtr_M00532  Photorespiration
mtr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MTR_7g021770
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MTR_7g021770
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MTR_7g021770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 11445602
NCBI-ProteinID: XP_003621694
UniProt: A2Q5A2
LinkDB All DBs
Position
7
AA seq 475 aa AA seqDB search
MSPQTETKATVGFKAGVKDYRLTYYTPDYETKDTDILAAFRVSPQPGVPAEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEESQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL
NATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAA
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGERDITLGFVDLLRDDFVEKDRSR
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREATKWSPELAAACEVWKEIKFELPAMDTI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagaaactaaagcaacggttgggttcaaagctggtgttaaagattat
cgattgacttattatactcctgactatgaaaccaaagatactgatatcttggcagcattc
cgagtaagtcctcaacctggagttccggctgaagaagcaggtgcagcggtagctgccgaa
tcttccactgggacatggacaaccgtgtggaccgatggacttaccagtcttgatcgttat
aaaggacgctgctaccacatcgaacctgttgctggagaagagagtcaatttattgcttat
gtagcttatcccttagacctttttgaagaaggttctgttactaacatgtttacctccatt
gtaggtaatgtatttgggttcaaggccttgcgtgctctacgtctggaagatttgcgaatc
cccgttgcttatgttaaaactttccaaggtcctcctcacggaatccaagttgagagagat
aaattgaacaaatatggacgtcccctattgggatgtactattaaacctaaattgggttta
tccgctaaaaattacggtagagcagtttatgaatgtctacgtggtggacttgattttacc
aaagatgatgaaaatgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagctatttataaagcacaggccgaaactggtgaaatcaaaggacattatttg
aatgctactgctggcacctgtgaagacatgatgaaaagagctgtatttgctagagaattg
ggcgtgcctatcgtaatgcatgactacttaaccggtggattcactgcaaatactaccttg
gctcactattgccgcgataatggtctacttcttcatatccaccgtgcaatgcatgcagct
attgatagacagaaaaatcatggtatgcactttcgtgtattagctaaagcgttacgtatg
tcaggtggagatcatattcacgctggtactgtagtaggtaaactggaaggagaaagggat
attactttaggttttgttgatttactacgtgatgattttgttgaaaaagatagaagtcgc
ggtatttttttcactcaggattgggtttctttacctggtgttctgcctgttgcttcaggt
ggtattcatgtttggcatatgcctgctctgaccgagatatttggagatgattctgtactt
caattcggtggaggaactttaggacacccttggggaaatgcacctggtgccgtagcgaat
cgagtagctctggaagcatgtgtacaagctcgtaatgaaggacgtgatcttgctcgtgag
ggtaatgaaattatccgtgaagctaccaaatggagtcctgaattagctgctgcttgtgaa
gtctggaaggagatcaaatttgaactcccagcaatggatactatttaa

DBGET integrated database retrieval system