KEGG   Medicago truncatula (barrel medic): MTR_7g022220Help
Entry
MTR_7g022220      CDS       T01716                                 

Definition
(GenBank) fanconi-associated nuclease-like protein
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mtr03400]
    MTR_7g022220
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     MTR_7g022220
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     MTR_7g022220
DNA repair and recombination proteins [BR:mtr03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     MTR_7g022220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC HIRAN Rho_N
Motif
Other DBs
NCBI-ProteinID: AES77951
UniProt: G7KUQ4
LinkDB All DBs
Position
7
AA seq 909 aa AA seqDB search
MVLSGRESLIRSIGKRRRFLPNRHSILSDPIPLSHQQPEQPTTAGSDSLENDVVICPVCS
LSLPDDNRLINSHLDSCLSEPKRSGTKRKLTQRTLLQLNFTRPDNLTHEPSHVLDTTCQE
QLVFSENHSVDVDLVDSAIVATATSSSLSLNFNEIDTDHHDVIEKNDVDDDDRCDIFGVK
FETLIVGRRYADKEDVCIGDNLSLLRDTQNVKDPNAIKVVSADSASSKFLGYLPREPAQY
LSPLIGNYNVVFQGHVTSVPKQPTDAVPIQIMCHRTPDGEIEYEDETFRCLWKKARHVVE
SAIKNPSSVKYQMNFCLMLQEVLRNNIHLLTEDEKTYTESFTSFSNDSQRLFLRLYTRKG
PWFRMSSISYPEIFDAQKAVKELAEKEYICSLEDGNQLCESDMNDILDVLTVSELREIWS
FLLKKSCGHGMKKQDLISSILSTYAGLWTHLSTMILDRTGFCVKISSKAESLIWRIERLF
FLNGEQDLSSFLLVDIGKVKYPTYTCTVLEPIFSSRTNLLAYEEAIELAQIMDEALDANK
TDVVLRCIKIAESRVSTVLPIEYLTSESVSTFHHLFTAPWVYSKVITLGISFLEQERRYS
DAVDLLKWLQNVYTCDVKRGYWTLRLSVDLEHLGYIDESLQVAENGLLDPWVRAGSRMAL
QRRVLRLGKPPRRWKVPSFSRSVLRKIPEVYVQGRPLNSELGAKNRFYNEEGTQCGVEEL
ALHYYAGEGWQGVHTESGIWLTVFGLLMWDVIYADVPNVFYTRFQNAPLDLGTDSFYTAR
KSIVESHMQQIRDGMAEEFLIKSWETHNGTSCRGVNWDRHSLDELRAAVTCVGGSCLASF
CLLLCEDYRSWSSGMPDLLLWRFCGEYSGEAKLVEVKGPKDRLSEQQRAWLLMLMDCGFM
VEVCKVKPL
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggtacttagcggcagagaaagtttgattcgatcaatcggaaaacgtcgtcgtttcctt
cccaatcgtcattctatcctctccgatcccattcctctgtcacaccagcaaccggaacaa
cctactacagccggtagcgactccctcgaaaatgacgtcgttatctgccccgtttgttca
ctctctcttcccgatgataaccgcctcatcaactctcatctcgattcgtgtctctctgaa
cctaaacgaagtggaacgaaacgaaaactcacacaacggaccctacttcagttaaacttc
acacgccctgataatctcacacacgagccttcacacgtgttggatacaacgtgtcaagaa
caattagtgttctctgaaaatcacagtgttgatgttgatcttgtggattctgcaattgta
gccactgcaacttcttcgtcgctgtccctgaatttcaacgagattgacactgatcatcat
gatgttattgaaaagaatgatgttgatgatgatgatagatgtgatatttttggagtgaag
tttgagactttgattgtgggtcggagatatgctgataaggaagatgtatgtattggagac
aatttgtctcttttgagagatacgcagaatgttaaggatccaaatgccatcaaggttgtt
tctgcagactctgcgtcttctaaatttctaggttatcttcctcgcgagccggcacaatat
ctatctccactaattggcaactacaacgttgtatttcagggacatgtcacttctgttccg
aaacagcctactgatgctgttccaattcagattatgtgccacagaacaccagatggtgaa
atagagtatgaagatgagacctttagatgcttgtggaagaaggctcggcatgttgttgag
tctgctatcaagaatccttcatctgtaaagtaccagatgaatttttgtcttatgctacaa
gaggtgttaagaaataatattcaccttctaacagaagatgaaaaaacctatacggagtca
ttcacttcattctcaaatgacagccagaggctcttccttcggctatacactagaaaagga
ccttggtttcgtatgtctagtatatcgtatcccgagatatttgatgctcaaaaggcagtc
aaggaacttgctgagaaagaatacatatgctctcttgaagatggaaatcaactatgtgaa
agtgacatgaatgatatattggatgtgctcactgtctctgagctgcgtgaaatttggtct
ttcttgcttaaaaagagttgtggtcacgggatgaagaagcaagatctaatttcatctatt
ctttctacatatgcaggattatggacacacctatcaaccatgattttggatagaactggt
ttctgtgtcaagatttcttcaaaagctgaatctcttatctggcgtatcgagaggcttttc
ttcttaaatggagagcaggatctctcgtcctttctactagttgatattggaaaagtcaaa
tatccaacttatacctgcacagtattggaaccaatattctcaagtcgcacgaatcttctt
gcatacgaagaggccattgaactggcacaaattatggatgaagctcttgatgcaaacaaa
actgatgtagtattgaggtgcataaagattgctgagtcccgtgtatccactgtgttgccc
attgaatacttgacttctgaatcagtgtctacattccatcacttatttacagcaccatgg
gtatactccaaagtgatcacattagggatttcctttcttgagcaagagcggaggtacagt
gatgcagttgacttacttaaatggctgcaaaatgtttacacttgtgatgtaaaaagagga
tattggacactgagattatccgttgacctggagcatctgggttacattgatgagagcctt
caagtggctgaaaatggattgctggatccatgggtacgagctggttctagaatggcattg
caaagacgggttcttcgcttaggaaaaccaccaagacggtggaaagttcctagtttttct
aggtctgtactgcgtaagatccctgaggtttatgttcaaggaagacctttgaattctgaa
ttaggagcaaaaaaccggttttacaatgaagaagggacgcaatgcggagtagaagagctt
gctttgcattattatgccggggagggatggcaaggtgttcatacagagagtggcatatgg
ttaactgtttttgggcttcttatgtgggatgtaatatatgctgatgtgcctaatgtcttc
tatactagatttcagaatgctcctttggatttgggtactgatagcttttatacggcgaga
aagagtatcgtagaatcacatatgcagcaaattcgtgatggcatggctgaggagtttctt
attaagtcatgggaaacacataatgggacatcttgtagaggagttaactgggaccgccat
tccttagacgagcttcgtgctgctgttacttgtgttgggggttcttgtttggcctctttt
tgcctgcttctttgtgaagactatcgaagttggtctagtggaatgcctgacctgctgctg
tggcgtttctgtggagaatacagtggtgaagctaagcttgttgaagtgaaaggtcctaag
gatcgactctcggaacagcagcgagcatggctactgatgcttatggattgtggattcatg
gtcgaggtttgtaaagtgaaacctttatag

DBGET integrated database retrieval system