KEGG   Medicago truncatula (barrel medic): MTR_7g082860Help
Entry
MTR_7g082860      CDS       T01716                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr03030  DNA replication
mtr03410  Base excision repair
mtr03420  Nucleotide excision repair
mtr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MTR_7g082860
   03410 Base excision repair
    MTR_7g082860
   03420 Nucleotide excision repair
    MTR_7g082860
   03430 Mismatch repair
    MTR_7g082860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mtr03032]
    MTR_7g082860
   03400 DNA repair and recombination proteins [BR:mtr03400]
    MTR_7g082860
Enzymes [BR:mtr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MTR_7g082860
    6.5.1.6  DNA ligase (ATP or NAD+)
     MTR_7g082860
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MTR_7g082860
DNA replication proteins [BR:mtr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MTR_7g082860
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MTR_7g082860
DNA repair and recombination proteins [BR:mtr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MTR_7g082860
   NER (nucleotide excision repair)
    Other NER factors
     MTR_7g082860
   MMR (mismatch excision repair)
    Other MMR factors
     MTR_7g082860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL UBA_4
Motif
Other DBs
NCBI-GeneID: 11442607
NCBI-ProteinID: XP_003624408
UniProt: G7KV95
LinkDB All DBs
Position
7
AA seq 1409 aa AA seqDB search
MAPKSKSQTLESLNSTQLYLNALQSLNLPPPTLPLPPLPSSTIPHSKLIPNTRFLIDSFR
HTTPSSFTYFLSHFHSDHYSPLSSSWSHGIIFCSPITSHLLINILHIPSPFVHPLSLNQS
VVIDGSVVTLIDANHCPGAVQFLFKVNETESPRYVHTGDFRFNREMLLDLNLGEFIGADA
VFLDTTYCHPKFVFPTQNESVDYIVDVVKECDGENVLFLVATYVVGKEKILLEIARRCGK
KVCVDGKKMEVLRALGYGESGEFTEDRLESNVHVVGWNVLGETWPYFRPNFVRMKEIMVE
RGYSKVVGFVPTGWTYEVKRDKFKVREKDSCKIHLVPYSEHSNYEELREYVRFLKPKKVV
PTVGLDVEKSDSKHVDKMRKYFAGLVDETANKHEFLKGFKQCDSGRSGFEVGKDVGNDTE
PGHSVEKEVKPSDVGGDKSIDQDVAMSLSSCMGETCIEDPTLLNDEEKEKVVQELSCCLP
TWVTRSQMLDLISISGSNVVEAVSNFFERETEFHEQVNSSQTPVPTHRSCSSNDTSPLSK
SNLKSFSSNDASPFSKSNLNNTNSTTKKLDLFRSQESKLTNLRKALSNQISPSKRKKGSE
SKSNKKVKVKAKSESSGSKQATITKFFGKAMPVMPGDTQSDQFGSKPGESPEVEELVPTD
AGNMYKQEIDQFMQIINGDESLKKQAITIIEEAKGDINKALDIYYSNSCNLGEREISVQG
ECKVDRPLEKKYVSKELNVIPDISMHRVLRDNVDATHVSLPSDKYNPKEHACWRDGQPAP
YLHLARTFSLLEDEKGKIKATSILCNMFRSLLVLSPEDVLPAVYLCTNKIAADHENVELN
IGGSLVTTALEEACGTNRLKIKEMYNKLGDLGDVAQECRQTQRLLAPPTPLLIKDIYSAL
RKISVQTGNGSTLRKKGIILHLMRSCREKEMKFLVRTLVRNLRIGAMLRTVLPALAHAVV
MNSRPTVYEEGTAENLKAALQVLSVAVVEAYNILPNLDIIVPTLMNKGIEFSVSSLSMVP
GIPIKPMLAKITNGIPQALKLFQNKAFTCEYKYDGQRAQIHKLVDGSVLVFSRNGDESTS
RFPDLVDMIKESCKPVASTFIIDAEVVGIDRKNGCRIMSFQELSSRGRGGKDTLVTKESI
KVGICIFVFDIMFANGEQLLGFPLRLRRKYLKALFYDERPGYFEYAKETSIEADDACLTC
EATLTRINAFLEDALHSSCEGIMVKTLDIDAGYSPSKRSDKWLKVKRDYVEGLNDTLDLV
PIGAWHGNGRKAGWYSPFLMACFNPETEEYQSVCRVMSGFTDSFYIEMKEFLSEDKLLSK
KPPYYQTGETPDMWFCPQLVWEIRGADFTVSPVHHAAIGLVHPSRGISIRFPRFICRVSD
RNPDECSTAADIVEMFHSQTRKMDVQIED
NT seq 4230 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaaatccaaatcccaaaccctagaatcgttaaactccacccaattatacctc
aacgcacttcaatccctcaatctcccaccacccaccctccccctcccaccactcccttcc
tccaccatcccccactccaaactcatccccaacacccgcttcctcatcgactccttccgc
cacaccaccccctcctccttcacctacttcctctcccacttccactccgatcactactcc
cccctctcttcctcctggtcccacggcatcatcttctgttctccaatcacctcccacctc
ctcattaacattctccacatcccatcccctttcgtccaccctctctctctcaaccaatcc
gtcgtcatcgacggctccgttgtaaccctaattgatgccaatcactgccctggcgccgtt
cagtttctttttaaagtgaatgaaactgaatcccctaggtatgttcatactggtgatttt
aggtttaatcgtgaaatgttgttggatttgaatcttggtgaatttattggtgcggatgct
gtgtttttggatacgacttattgtcatcccaaatttgtttttccgactcaaaatgaatcg
gttgattatatcgttgatgtcgtaaaggaatgtgatggtgagaatgttttgtttcttgtt
gctacttatgttgttggtaaggagaagattttgcttgagattgcacggaggtgtgggaag
aaagtgtgtgtggatggaaaaaagatggaggttttgcgggctcttgggtatggtgagagt
ggtgagtttaccgaggataggttggagagtaatgtgcatgttgttgggtggaatgtgttg
ggggagacttggccttattttaggccgaattttgttaggatgaaggagattatggttgag
agagggtattctaaggttgtggggtttgtgccgactggatggacttatgaagtgaagcgt
gataagtttaaggttagggagaaagattcgtgtaagattcatcttgtgccgtatagtgag
cattcgaattatgaggagcttagggaatatgtgaggtttttgaaaccgaagaaggtcgtt
ccaactgtgggtttagatgttgaaaagagtgatagtaaacatgttgataaaatgaggaag
tattttgctggattggttgatgagacggccaacaagcatgagtttttaaagggttttaag
cagtgtgactctggtagatcgggttttgaggtcgggaaggatgttggtaatgatacggaa
ccagggcatagcgtcgagaaagaggtgaagccgtctgatgtgggaggggataaaagtatt
gatcaggatgttgctatgagtctatcatcttgtatgggagaaacttgcatagaagatcct
acgttgctaaatgatgaggaaaaagagaaagttgttcaggaattaagttgttgtttgccc
acatgggtcacccgaagccagatgttagatctgatcagcatctctgggagcaacgtcgtt
gaagctgtttctaatttctttgaacgtgaaactgaatttcatgagcaagtaaattccagt
caaactccagttccaacacacagatcttgctcatcgaatgacaccagtccgctttcaaaa
tcaaatctcaagtctttctcatcgaatgacgccagtccgttttcaaaatcaaacctcaac
aatacaaacagcactacaaaaaaattggacctttttcgaagtcaagagtctaaattgact
aacctaaggaaagcactatcaaatcagatttccccttccaaaagaaagaagggtagtgaa
agtaagtcaaacaagaaagtaaaagtcaaagcaaaatcagaatcaagtggttcaaagcag
gcaacaataacaaaattctttggcaaagcaatgcctgtgatgcctggtgatactcaatct
gatcaatttggatcgaagcctggtgagagccccgaagttgaagaattggtgccaactgat
gctggaaatatgtataagcaagagattgatcagtttatgcaaataataaacggggacgag
tcattgaaaaagcaagcaattactataattgaggaggcaaaaggagacatcaacaaggca
ttggatatatattactctaattcttgcaatcttggtgaaagggaaatatcagttcaaggg
gaatgcaaagttgacagacctttagagaagaagtatgtgtcaaaagagttgaatgttata
cctgatatttctatgcatagagtattaagagataatgtagatgcaactcatgtatcacta
ccatctgataaatacaaccccaaagaacatgcgtgttggagagatggacaaccggcgcca
tatttacatcttgcacgaaccttcagcctgcttgaggatgagaaaggaaagataaaagct
acttccatactatgcaacatgttcagaagtttgttggtcttgtctccagaagacgtgctt
cctgctgtgtatctatgtacaaacaaaattgctgcagaccatgaaaatgtggaactaaat
attggtggaagtttagtcactacagcactcgaagaggcatgtgggacaaaccgattgaaa
ataaaggagatgtataataaactgggcgaccttggtgatgttgctcaagagtgtcgtcaa
acacagagattgcttgcaccacctacaccgcttctaattaaggatatttactctgcactg
cgaaagataagtgtacaaacaggcaatggaagcacattacgaaagaaaggcatcattctt
catctcatgcgttcttgccgtgaaaaggagatgaagtttcttgttcgaaccttggtcagg
aacttgaggattggggcaatgcttagaactgttttgcctgcattggctcatgctgttgtt
atgaattctcgcccaactgtgtacgaagaaggaacagcagaaaatttgaaggcagcgctt
caggtcctttctgtggcagttgttgaagcatataacatactgccaaatttggatatcata
gtaccaactctcatgaacaaaggcattgagttttcagtttcaagtttatcaatggttcca
ggaatcccaatcaagcctatgcttgcaaagatcaccaatggcattccccaagcattgaag
ctatttcaaaataaagcattcacatgtgaatataagtatgatggtcagcgagctcaaatt
cacaaattagttgatggatcagttcttgttttttcaagaaatggagatgaatcaacttcg
agattccctgatctggttgacatgataaaggaatcttgcaagcctgttgcatcaactttc
ataattgatgccgaggttgttggcattgatagaaaaaatggatgtaggattatgtctttc
caggagctatcttcacgtgggagaggaggcaaggatactttagtcaccaaagagagcata
aaggtgggcatttgcatctttgtcttcgatatcatgtttgcaaatggagaacagttactg
ggtttccctctccgcctaagacgaaagtatctgaaggctttgttctatgatgaacgacct
gggtattttgaatatgcaaaagaaacatctatagaagcagatgatgcttgcttaacatgt
gaagccacattaactagaataaatgctttccttgaagatgcactgcactcttcatgtgaa
ggaattatggtgaaaacgttggatattgatgctgggtattctccatcgaagcgttctgac
aaatggttaaaggtcaaacgagattatgtggaaggattaaatgatactcttgatttagta
ccaattggtgcttggcatggaaatggaaggaaagctggatggtatagtccatttctcatg
gcatgtttcaatcctgaaactgaagagtatcaaagtgtgtgccgagtaatgtctgggttc
acagactctttttacattgagatgaaagaattcttatctgaggacaaattgttgtcaaaa
aagccgccatattatcaaacaggagagacaccagacatgtggttttgtccacaacttgtt
tgggaaataagaggtgcagactttacagtatccccagttcaccatgctgccattggtttg
gttcatccttctagaggcatctctatcagatttccaagatttatttgcagagtgtcagac
agaaacccagacgaatgcagcactgctgctgatatagttgaaatgtttcattcccagact
cggaaaatggatgtccaaattgaagattga

DBGET integrated database retrieval system