KEGG   Medicago truncatula (barrel medic): MTR_7g114240Help
Entry
MTR_7g114240      CDS       T01716                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MTR_7g114240
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MTR_7g114240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 11432262
NCBI-ProteinID: XP_003626362
UniProt: B7FGV9
LinkDB All DBs
Position
7
AA seq 152 aa AA seqDB search
MVKAVAVLGNSNDVSGTISFTQEGNGPTTVTGNLSGLKPGLHGFHIHALGDTTNGCLSTG
PHFNPNGKEHGAPEDETRHAGDLGNVTVGDDGTASFTITDNQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggcagttcttggtaacagtaatgatgtctctggtactattagcttc
actcaggagggaaatggtccaaccactgtgactggaaatctttctggtcttaagcctggc
ctccatggcttccatatccatgccttgggggacaccacgaatggttgcttgtcaaccgga
ccacatttcaatcctaatggtaaggagcacggtgcccctgaggatgagactcgacatgct
ggtgatttaggaaatgtcaccgtcggtgatgatggaaccgcaagcttcactattactgac
aatcagatccctctcaccggaccaaactcaatcataggaagggctgttgttgttcatgct
gatcctgatgatcttgggaaaggtggtcatgagcttagcaagactactggaaatgctggt
ggcagagtagcttgtggtattattggtttgcaaggatga

DBGET integrated database retrieval system