KEGG   Medicago truncatula (barrel medic): MTR_8g023140Help
Entry
MTR_8g023140      CDS       T01716                                 

Definition
(RefSeq) alanine aminotransferase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00220  Arginine biosynthesis
mtr00250  Alanine, aspartate and glutamate metabolism
mtr00710  Carbon fixation in photosynthetic organisms
mtr01100  Metabolic pathways
mtr01200  Carbon metabolism
mtr01210  2-Oxocarboxylic acid metabolism
mtr01230  Biosynthesis of amino acids
Module
mtr_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MTR_8g023140
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MTR_8g023140
   00220 Arginine biosynthesis
    MTR_8g023140
Enzymes [BR:mtr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MTR_8g023140
Amino acid related enzymes [BR:mtr01007]
 Aminotransferase (transaminase)
  Class I
   MTR_8g023140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 11444017
NCBI-ProteinID: XP_003627448
UniProt: G7L970
LinkDB All DBs
Position
8
AA seq 524 aa AA seqDB search
MRKSAADRFRHLFNRSLVFVRNQNQQYHHPSPLRSLSSMASDSPFPVTAQNINPQVLKCQ
YAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQPITFFREVLALCDYPA
LLDKSETQGLFSADSIERAWQIVDQIPGRATGAYSHSQGIQGLRDTIAAGIEERDGFPCN
ANDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASITLHGGHLVPYYLDEATG
WGLEISELKKQLEDAKSKGISVRALAVINPGNPTGQVLAEDNQRAIVEFCKQEGLVLLAD
EVYQENVYVPEKKFHSFKKVSRSMGYGDNDICLVSFQSVSKGYHGECGKRGGYMEVTGFS
PDVREQIYKVASVNLCSNITGQILASLIMSPPKVGDESYESFMAERGAILSSLTTRAKAL
EEALNKLEGVTCNKAEGAMYLFPRIRLPEKAIKAAEAEKSAPDAFYCKRLLNATGIVVVP
GSGFGQVPGTWHFRCTILPQEDRIPAIVTRLTEFHQKFMDEFRD
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaatccgctgcagatagattcagacatcttttcaaccgttcgcttgtctttgtt
cggaatcaaaaccaacaatatcaccatccttctccccttcgttctttgtcttcaatggct
tctgattcacctttccctgttaccgctcaaaatattaaccctcaggttctgaaatgtcag
tatgctgttcgaggagagattgttacacttgctcagaacttgcaaaaagctttgcaagcc
aatccagatgctcattcgtttgatgagataatttactgcaacattggaaatcctcagtct
ctgggccagcagccaattacttttttccgagaggttcttgctttatgtgactatccagct
cttctggacaaaagtgaaacacagggtttgttcagtgctgattcaatagagagagcttgg
caaattgtggatcagattcctggaagagcaactggtgcctatagtcatagtcagggtatt
cagggtttacgtgatacaatagccgctggaattgaagagcgtgatggttttccttgtaat
gccaatgacattttcttgacagatggtgcaagcccagcagtccatatgatgatgcaatta
ctcattagatcggaaaaggatggtattttgtgtcccatcccccagtaccctctctattca
gcctcaattaccctccatggtggccacctggtaccatattatcttgatgaagcaactggt
tgggggctggaaatatctgaactcaagaagcagttggaagatgccaagtccaaaggcatc
agtgttagggctttagctgttataaatcccggcaatccaacagggcaggttcttgctgag
gataatcaacgggctatagtagaattttgcaagcaagaaggtttggttcttttggctgat
gaggtttatcaagaaaatgtttatgttcctgagaagaaatttcactctttcaagaaggta
tctcgatccatgggatatggtgacaacgatatctgcttagtatcttttcagtccgtctcc
aaaggctatcacggggagtgtggaaaacgaggaggttatatggaggtgactgggttttct
ccagatgtaagggaacaaatttataaagtggcatctgtgaatctttgttcaaacatcact
ggtcaaattcttgcaagtttgatcatgagtccgcctaaggttggagatgagtcttatgag
tcattcatggctgagaggggtgctattttatcttcccttacgacgcgtgcaaaggcactg
gaagaggctttaaacaaattagagggtgtaacctgcaacaaagcagaaggagcaatgtat
ctgtttccacggattcgcctgcctgaaaaggctatcaaagctgcagaggctgaaaagtcc
gcacctgatgccttctattgcaaacgcttacttaatgccactggaattgtcgttgttcct
ggttctggttttggacaggttcctggcacatggcattttaggtgcaccatattgcctcaa
gaagataggattccggccattgtcacccgcttgacagagttccatcaaaagttcatggat
gagtttcgcgattga

DBGET integrated database retrieval system