KEGG   Medicago truncatula (barrel medic): MTR_8g070070Help
Entry
MTR_8g070070      CDS       T01716                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, suvh protein, putative
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    MTR_8g070070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mtr03036]
    MTR_8g070070
Enzymes [BR:mtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MTR_8g070070
Chromosome and associated proteins [BR:mtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MTR_8g070070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 25501522
NCBI-ProteinID: XP_013446218
UniProt: A0A072U350
LinkDB All DBs
Position
8
AA seq 769 aa AA seqDB search
MDPFSLTLETPSPSQPSSHVSVAIPTPNFTISNQIPNFSPSPPTTTISSGAPLQTLLVPK
PEPFDDFFATQDSQQQPHFSPGSETDDQSDLYTEYYRISQLFNATFGKSLYPFMGIDDSN
NASAVSMENLVNGCNPDLNLNPPNLRVDSIDSEPCEGNDRAIVVVPEKQETAVAVVRKKA
SQVMELVRVSDLSMKDQMHFRDVMRKTRMIYDSLRVLASVEEEKRMADERKLAAEVAVEE
ERRLSEERRLAEERMLAAEVAVMEAEMRVGEESRVAAAGLEGEMSSGRRRRGRNRIRGDM
RAAALMRKRELWLYRDKRIVGPIPGVYVGDVFLFRMELCVIGLHMQIQAGIDYLPKSRCS
NGEPIATSVIVSGGYEDDMELDDGDVIIYTGHGGQEKNSSRQICDQKLVGGNLALERSMH
YGIEVRVIRGMKYEGSASGSGKVYVYDGLYRIVDCWFDVGKSGFGVYKYKLWRIEGQAKM
GSAVLKEAREIKKIGLDVKPMYCLSVDISHKRENVPIRLFNDIDDNQEPLYYEYLPKTTF
PQFVFHQSGNATGCECVEACTDGCFCSMKNGGEFPYNLQGLLVRGRPLIFECGPFCSCPP
NCRNRVAQKGIRHRLEVFRSAQTGWGVRSLDLIQAGAFICEYTGVILTREQAQILTMNGD
SLIYPNRFSDRWAEWGDLSQIYTDHVRPSYPSIPPLDYSLDVSTMRNVACYMSHSSSPNV
FVQYVLYDHNNLMFPHVMLYAMENIPPLRELSIDYGIADEWTGKLSICM
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggatcctttctcattaacccttgaaactccttctccttctcaaccttcttctcatgtt
tctgttgctattcccacccccaattttactatttccaaccaaatccctaatttctcacct
tcacccccaactaccaccatttcctccggagcaccgcttcagacgctgctcgttccaaaa
ccggagcctttcgatgatttcttcgcgacccaagattctcaacaacaaccccatttctct
cctggctcagaaaccgatgatcaatctgatttatacactgagtactaccgtatttcacag
cttttcaatgctacttttggtaaatcgctttacccttttatgggaatcgatgattccaac
aatgcttctgctgtttcaatggagaatttggtcaatggttgtaaccctgacctaaatctc
aaccctcctaatttgagggtggattctattgattctgagccctgtgagggaaatgatcga
gcgattgttgttgttccggagaaacaagagacggcggttgcggtggttaggaagaaagca
agtcaagtgatggagcttgtgagggtttcagatctgagtatgaaggatcagatgcatttt
cgtgatgtgatgaggaagactaggatgatttatgattcgctccgcgtgttggcaagtgtt
gaggaggagaagagaatggctgatgagaggaaattggctgctgaagttgctgtggaggaa
gagaggagattgtctgaggagaggaggttggctgaggagaggatgttggctgctgaagtt
gcggttatggaggcagagatgagagtcggtgaggagagtagggtggcagctgcagggttg
gaaggggagatgtcgagtggaagaaggcgtcgtggtcgtaatcgcattcgtggtgatatg
agggctgctgcgttaatgaggaagcgtgagttgtggctgtatcgcgataagaggatagtt
ggaccgatacctggagtttatgttggtgatgtgtttttgtttaggatggaattgtgtgta
attggtttgcatatgcagatacaagctggcattgattacctgcctaaaagtaggtgctca
aatggtgaaccaattgctaccagtgtgattgtttcgggtggttatgaggatgatatggaa
ttggatgacggtgatgttataatctacactggccatggagggcaggagaagaattcctca
aggcaaatttgtgatcagaaattggtgggcggaaaccttgctttggaaaggagtatgcat
tatggaatcgaggttagggttattcgtgggatgaagtacgaagggagcgcatccggttct
ggtaaggtttatgtttatgatggattgtataggattgttgattgttggtttgatgtagga
aagtctggttttggagtttataagtataagctatggagaattgaggggcaggctaagatg
ggtagtgctgttctcaaagaggctagggagattaagaaaattgggttggatgttaagcct
atgtattgtctttctgttgatatttcacacaagagggagaatgttcctattaggctattt
aatgatatagatgacaatcaagaacctctttattatgagtatcttccgaaaactactttt
ccgcagtttgtgtttcatcagagtgggaatgctactggctgtgaatgtgtggaggcttgt
actgatggctgcttttgctctatgaagaatggaggagagtttccctataatcttcagggt
ttgcttgtgagagggaggcctttgatttttgaatgtggccctttttgctcctgtcctccc
aattgtcggaatcgtgttgcacaaaaggggatcaggcataggttggaagtgtttaggtct
gcgcagactggttggggagttaggtctttggaccttattcaagccggagcctttatctgc
gagtatacaggggtaattttaacaagggagcaagctcaaattttaacaatgaatggggac
tccttaatatatcctaatcggttttcagatagatgggcagaatggggggatttgtctcag
atatacactgatcatgtgcgtccatcgtatccctcaattcctcctttagattattctctg
gatgtatcaacaatgagaaatgttgcttgttacatgagccatagttcgagtccaaatgtg
tttgttcagtatgttctgtatgatcacaacaatttaatgttccctcatgttatgctatat
gcaatggagaacatccctcctctgagagaactcagcatagattatggcatcgcagatgag
tggacaggcaagctgtctatatgtatgtaa

DBGET integrated database retrieval system