KEGG   Medicago truncatula (barrel medic): MTR_8g102460Help
Entry
MTR_8g102460      CDS       T01716                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00010  Glycolysis / Gluconeogenesis
mtr00051  Fructose and mannose metabolism
mtr00052  Galactose metabolism
mtr00500  Starch and sucrose metabolism
mtr00520  Amino sugar and nucleotide sugar metabolism
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
mtr01200  Carbon metabolism
Module
mtr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_8g102460
   00051 Fructose and mannose metabolism
    MTR_8g102460
   00052 Galactose metabolism
    MTR_8g102460
   00500 Starch and sucrose metabolism
    MTR_8g102460
   00520 Amino sugar and nucleotide sugar metabolism
    MTR_8g102460
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MTR_8g102460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mtr04131]
    MTR_8g102460
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MTR_8g102460
Membrane trafficking [BR:mtr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MTR_8g102460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 11408101
NCBI-ProteinID: XP_003630707
UniProt: G7L7F0
LinkDB All DBs
Position
8
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMISSRKWTRSVSILKEFGEKCETPIGKLRQLAD
AMDVEMHAGLASEGGSKLSMLISYVDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKEKG
VISQEFDEVSIPPQLMTGSSEGLFDFIAAALAKFVESEPEGFHPPPGRQRELGFTFSFPV
KQTSIASGTLIKWTKGFSIDDTVGEDVVGELTKSLEKIGLDMRVAALVNDTIGTLAGGRF
YNQDVIAAVILGTGTNAAYVEHAHAIPKWHGLMPKSGDMVINMEWGNFRSSHLPLTEYDQ
DLDAESLNPGEQIFEKLLSGMYLGEIVRRALLKMAEEAEFFGDTVPPKLKIPFILRTPDM
SSMHHDTTPDLKEVGSKLRDILEISNTSLKMRKIVVELCDIVASRGARLAAAGILGILKK
LGRDTVKGGEKQKSVIALDGGLFEHYTKFRVCLEDTLKELLGDEAAETVVVEHANDGSGI
GAALLAASHSQYLGVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggtcgcggtgggagctgcggttgtttgtgctgccgccgtttgtgccgcggcg
gcacttgtggtgcgccaccgtatgataagttcgagaaagtggacacgtagcgtgtctatt
ttgaaggagtttggggaaaagtgtgagacaccaattggaaagcttagacagttggctgat
gctatggatgttgagatgcatgctggtcttgcatctgaaggtggcagcaagcttagcatg
ttaatcagctatgttgataatcttcctactggggatgaggaaggactctattatgctcta
gatcttggtggaacaaacttccgtgtccttcgtgtacatttaggtggaaaagagaaaggt
gtcattagccaagagtttgatgaagtttcaattcctcctcaattgatgaccggttcttca
gagggattatttgattttatagcagcagctctcgcaaaatttgttgagtcagaacctgaa
ggttttcatcctccacctggcagacaaagagagctcggttttacattctcgttccctgtg
aagcaaacctcaattgcatctgggactctaataaagtggactaagggtttcagtattgat
gataccgttggcgaagatgtggtgggagaactaaccaagtccttggaaaaaattggcctg
gatatgcgtgttgcagctctagttaatgatacaattggaacattggctggaggcagattc
tacaatcaggatgtcattgctgctgtgattctcggtactgggacaaatgcagcatatgta
gaacatgcacatgctattccaaaatggcatggccttatgccaaaatcaggagatatggtt
ataaacatggaatggggtaatttccgatcatcacatcttcctttaacagaatatgatcaa
gatcttgatgctgaaagcttaaaccctggagaacagatttttgagaaattgctttctggc
atgtacttgggggaaattgtacggagagctttgttgaagatggccgaagaggctgaattt
ttcggagatactgttccccctaagttgaaaattccttttatacttaggacacctgacatg
tcttccatgcaccacgacacaacaccagatttgaaagaggttggaagcaaattgagggat
atattggagatctctaatacatcactaaaaatgaggaagattgttgtggaactctgtgac
attgtagccagtcgcggtgcacgccttgctgctgctggtattttgggaatccttaagaaa
ctaggaagagacacagttaagggtggagagaagcaaaagtcagtgatagcattggatgga
gggttgtttgaacactacactaaattcagagtttgcttggaggatacgctgaaggaattg
cttggagatgaggcagctgaaaccgttgtcgttgagcatgctaatgatggttcaggcatt
ggagcagcgcttctagccgcttctcactctcagtatttgggagtagaagagtcctaa

DBGET integrated database retrieval system