KEGG   Medicago truncatula (barrel medic): MTR_8g463920Help
Entry
MTR_8g463920      CDS       T01716                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00620  Pyruvate metabolism
mtr00710  Carbon fixation in photosynthetic organisms
mtr01100  Metabolic pathways
mtr01200  Carbon metabolism
Module
mtr_M00168  CAM (Crassulacean acid metabolism), dark
mtr_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
mtr_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
mtr_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MTR_8g463920
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MTR_8g463920
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MTR_8g463920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 E2R135
Motif
Other DBs
NCBI-GeneID: 25502534
NCBI-ProteinID: XP_013445533
UniProt: A0A072TPW7
LinkDB All DBs
Position
8
AA seq 967 aa AA seqDB search
MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV
YELSAEYEGKHDPQKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIK
LKKGDFADENNATTESDIEETIKRLVGELNKTPQEVFDALKNQTVDLVLTAHPTQSIRRS
LLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWMGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRAEELNRSSKKDAVAKHYIEFWKN
IPPNEPYRVILGEVRDRLYQTRERSRHLLAHGYSDIPEENTFTNVDEFLEPLELCYRSLC
ACGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLEIGSYQEWSED
KRQQWLLSELSGKRPLFGPDLPQTEEIKDVLDTFHVIAELPSDNFGAYIISMATAASDVL
AVELLQRECHVKQPLRVVPLFEKLADLEAAPAALARLFSIDWYRNRINGKQEVMIGYSDS
GKDAGRFSAAWQLYKAQEELIKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALMDQMAIIA
TEEYRSMVFQEPRFVEYFRLATPELEYGRMNIGSRPAKRKPSGGIETLRAIPWIFAWTQT
RFHLPVWLGFGAAFKNVIDKDIRNLQMLQEMYNQWPFFRVTIDLIEMVFAKGDPGIAALY
DRLLVSNDLWSFGEQLRTKFEETKKLLLQVAAHKDLLEGDPYLKQRLRLRDSYITTLNVC
QAYTLKRIRDPNYNVKLRPHISKESIEISKAADELVTLNPTSEYAPGLEDTLILTMKGIA
AGLQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaggaaccttgaaaagatggcatccatcgatgctcagcttcggcaattggtt
cctgcaaaagtgagtgaggatgataaactggttgagtatgatgctttgctcttggaccgt
ttccttgatattcttcaggatttacacggtgaggatctcaaggaaacagttcaagaagta
tatgaactttctgctgagtacgaaggaaagcatgatcctcaaaaacttgaagaacttgga
aatctcataacaagtttggatgctggagattctattgttgttgccaaatccttttctcat
atgcttaacttggctaacttagctgaggaggtccaaattgctcaccgtcgaaggattaag
ttgaaaaagggtgattttgctgatgagaacaatgcaacaacagaatcagatatcgaagaa
actattaagagacttgttggtgagttgaacaagactcctcaggaagtttttgatgcactt
aaaaaccagaccgttgatctcgttcttactgctcatccaacgcaatcaattcgcaggtct
ttgcttcaaaagcatggaaggatacgtaattgtttaacacaattgtatgccaaagacatc
actcctgatgataagcaggagctcgatgaggctctacaaagggagatccaagctgccttc
cgtactgatgaaatcaggaggacccctccaaccccacaagatgagatgagagccgggatg
agctacttccatgaaacaatttggatgggtgtacctaaatttctccgtcgtgttgataca
gctttaaagaatatagggattaatgaacgtgtcccatataatgctccacttattcagttt
tcttcttggatgggtggtgatcgtgatggaaatccaagagtaactcctgaagtgacaaga
gatgtttgcttattggctagaatgatggctgctaatttgtattactcccaaatagaggat
cttatgtttgaactgtcaatgtggcgttgcaatgacgagctacgtgttcgtgcagaagaa
cttaataggtcttccaagaaagatgcagttgcaaaacactacatagagttttggaaaaac
attcctccaaatgaaccataccgagtgatacttggtgaagtaagggacagactctaccaa
actcgtgagcgttctcgccatttgttagctcatgggtactcggacattccagaggaaaat
actttcaccaatgttgacgagttcttggaacctcttgaactctgttatagatcactttgt
gcttgtggtgatcgcgcaattgctgatggaagtcttctagatttcttgaggcaagtctct
acttttggtctgtcactagtgaggcttgatattaggcaagagtcagaccgtcacactgat
gtgttggatgccataaccaaacaccttgaaattggctcctaccaagaatggtctgaagat
aaacggcagcaatggcttttgtctgaattgagtggcaaacgccccttgttcggacctgac
cttccccaaaccgaagaaattaaagatgttttggatacatttcatgtcatagcagaacta
ccatcagacaactttggagcatatatcatatcaatggcaactgcagcatccgatgttcta
gcagttgaacttttgcaacgtgaatgccatgtcaagcaaccattgagagttgtaccattg
tttgagaagcttgcagatctggaggcagctcctgctgctttggcccggttgttctcaata
gattggtacagaaatcggatcaacgggaaacaagaagtcatgattgggtactccgattca
ggtaaagatgccggaaggttttctgcagcatggcagctatacaaggctcaagaggagctt
ataaaggtagctaaggagtatggtgttaaactaactatgttccacggtcgtggagggact
gttgggagaggtggtggtcccactcatcttgctatcctgtctcagcctccagatacaatc
catggatcacttcgtgtaactgtacaaggcgaagttattgagcaatcatttggtgaggag
cacttgtgtttccgaacactacaacgtttcactgcagctactctagagcatggaatgcat
ccaccaatttctcccaaaccagaatggcgtgcgttgatggatcagatggctatcattgcc
acagaggaataccgttctatggtattccaagaacctcgttttgttgagtatttcaggctg
gctactccagagttggagtatggccgcatgaatatcggaagtcgacctgcaaagcgaaag
ccaagcggaggtattgagactctccgtgctattccttggatctttgcctggacacaaaca
aggtttcatcttccagtgtggctaggctttggggccgcattcaagaatgttattgacaag
gatattagaaatcttcaaatgcttcaagagatgtacaatcaatggcctttctttagggtc
actattgatttaattgaaatggtgtttgccaagggagacccaggtattgctgctctgtat
gacaggctccttgtttcaaacgatctatggtcatttggggagcagttgagaaccaaattt
gaagaaaccaagaaactcctacttcaggtggctgcgcacaaggatcttcttgagggagac
ccttacttaaagcaaagactccgcctgcgtgattcatacataactaccttgaatgtgtgc
caggcttacacattgaaacgcatccgtgatccaaactataatgtgaaactacgtccccac
atctctaaagagtctatagagataagtaaagctgctgatgaacttgtaacactgaaccca
acaagtgaatatgcacctggtttggaagacaccctcattctcaccatgaagggtattgct
gctggcttgcaaaacactggttaa

DBGET integrated database retrieval system