KEGG   Microbacterium testaceum: MTES_0116Help
Entry
MTES_0116         CDS       T01423                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mts  Microbacterium testaceum
Brite
KEGG Orthology (KO) [BR:mts00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mts01001]
    MTES_0116
Enzymes [BR:mts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MTES_0116
Protein kinases [BR:mts01001]
 Serine/threonine kinases: Other
  Bacterial family
   MTES_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo Pkinase_fungal Kinase-like Haspin_kinase RIO1 FTA2
Motif
Other DBs
NCBI-ProteinID: BAJ73080
UniProt: E8N860
LinkDB All DBs
Position
107575..109524
Genome map
AA seq 649 aa AA seqDB search
MSTSQQADPLIGRLVDGRYRVRARIARGGMATVYVATDLRLERRVALKVMHGHLSDDTVF
QSRFIQEARSAARLSDPHVVNVFDQGQDGEMAYLVMEYLPGITLRELLREHKRLTVDQTL
TIMDAILSGLAAAHRAGIVHRDVKPENVLLAEDGRIKIGDFGLARATTANTASGAQLMGT
IAYLAPELVTRGTADARSDIYSLGIMLYEMLTGEQPYKGEQPMQIAYQHATDSVPRPSAK
NPSVPEQLDELVLWSTEREPDDRPLDAGAMLQRLREVEKELGLAPQVARAVSVGTVGPAS
PAESRELTKVLPQTATIPDAPTEDVDNATRLRAKTRRRTARGVWLLLLVLVLAGGSAATG
WWFGSGPGSLVEVPDVSQRSFADAESLLTQNQLRAQSQDVNDREIPAGTTVGSDPVAGSR
LDKETVVTVFVSAGPATHQLPELQGKSVEEVRGILEAAFVGVGDVAQEFTDAGPDTVLSA
SITPRSGGDAIDCTGGCTVYEGDAATLTASLGPVPDVAGLKTADAESKLQAANLKTTTSE
EYSNSVASGTVIAIGDRDGGGNWRPGDTVTLRVSIGPKPVMIPENIVGMSIRDAVTALEN
LGFEVNAGIDDGTLPLGFKYWDIYKVRSSNPKAGTTAPQGSTITLTPTL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgagtcagcaggccgacccgctgatcggccgtctcgtcgacggccggtaccgg
gtgcgcgcgcgcatcgcgcgcggcggcatggcgaccgtgtacgtcgcgaccgacctgcgc
ctggagcgccgggtcgcgctgaaggtcatgcacgggcacctcagcgacgacaccgtgttc
cagagccggttcatccaggaggcgcgctcggcggcgcgtctgagcgacccgcacgtcgtg
aacgtgttcgaccagggccaggacggcgagatggcctatctcgtcatggaatacctgccg
ggcatcacgctgcgcgagctgctgcgcgagcacaagcgcctcacggtcgatcagaccctg
acgatcatggatgccatcctgtcgggcctcgccgccgcccaccgcgccggcatcgtccac
cgcgacgtcaagcccgagaacgtgctcctcgccgaggacgggcgcatcaagatcggcgac
ttcggtctggcccgcgcgacgaccgccaacaccgccagcggcgcgcagctgatgggcacg
atcgcctacctcgcacccgagctcgtgacccgtggcacggccgacgcgcgcagcgacatc
tactccctcggcatcatgctgtacgagatgctcacgggcgagcagccctacaagggcgag
cagccgatgcagatcgcctaccagcacgcgaccgactcggtgccgcggccgagcgcgaag
aacccgtcggttcccgagcaactcgacgagctcgtgctctggtcgaccgagcgagagccc
gacgaccgccccctcgacgccggcgcgatgctgcagcgactccgcgaggtcgagaaagag
ctcggcctcgccccgcaggtcgctcgagccgtctccgtcggcaccgtcgggcccgccagc
cccgcggaatcccgggagctgacgaaggtgctcccccagaccgccacgatcccggacgcc
ccgaccgaggacgtcgacaacgcgacgcggttgcgcgccaagacgcgccgacgcacggcg
cgcggcgtgtggctcctgctgctcgtcctggtgctcgcgggtgggtcggcggcgaccgga
tggtggttcggctccggacccggctcgctcgtcgaggtgcccgacgtctcgcaacggagc
ttcgcggatgccgagagcctgctgacccagaatcagttgcgcgcgcagtcgcaggacgtg
aacgaccgcgagattcccgccggaacgacggtcggatctgatccggtggcgggttcccgt
ctcgacaaggagaccgtggtgacggtcttcgtctcggcgggaccggccacccaccagctg
ccggagctccagggcaagagcgtcgaggaggtccgcggcatcctcgaggccgcgttcgtc
ggcgtgggggacgtcgcgcaggagttcaccgacgccggccccgacaccgtcctgtcggca
tccatcactccccgctccggcggcgacgcgatcgactgcacgggcggctgcacggtctac
gagggcgacgccgcgacgctgaccgcgtcgctcggacccgtgcccgatgtcgcggggctg
aagacggcggatgccgagagcaagctgcaggccgcgaacctgaagaccacgacgagcgag
gagtacagcaactccgtcgcctcgggcaccgtgatcgcgatcggcgaccgcgacggcggg
ggcaactggcgacccggagacacggtcacgctgcgggtgtcgatcgggccgaagccggtg
atgatccccgagaacatcgtgggcatgtccatccgggatgccgtgacggcgctggagaac
ctcggcttcgaggtcaacgcgggcatcgacgacgggacgctcccgctcgggttcaagtac
tgggacatctacaaggtccgttcgagcaaccccaaggccgggacgacggccccgcagggc
agcacgatcacgctgacgccgacgctgtag

DBGET integrated database retrieval system