KEGG   Microbacterium testaceum: MTES_0648Help
Entry
MTES_0648         CDS       T01423                                 

Gene name
gabD
Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
mts  Microbacterium testaceum
Pathway
mts00250  Alanine, aspartate and glutamate metabolism
mts00310  Lysine degradation
mts00350  Tyrosine metabolism
mts00650  Butanoate metabolism
mts00760  Nicotinate and nicotinamide metabolism
mts01100  Metabolic pathways
mts01120  Microbial metabolism in diverse environments
Module
mts_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MTES_0648 (gabD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MTES_0648 (gabD)
   00310 Lysine degradation
    MTES_0648 (gabD)
   00350 Tyrosine metabolism
    MTES_0648 (gabD)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MTES_0648 (gabD)
Enzymes [BR:mts01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     MTES_0648 (gabD)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     MTES_0648 (gabD)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     MTES_0648 (gabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF3102 DUF1487
Motif
Other DBs
NCBI-ProteinID: BAJ73612
UniProt: E8NCG4
LinkDB All DBs
Position
complement(692615..694087)
Genome map
AA seq 490 aa AA seqDB search
MTDSRESELLASVPTGLLINGEWRAATGGKTVAVNDPATGEVIHEIADATVDDGVAAMDA
AAEAFPSWAATPARERAEILRRAFDLLQERKEDIALLMTLEMGKPLAEARGEVGYGGEFL
RWFSEVTAHTQGRYGANPEGTGRMIVTQHPVGPCYLITPWNFPLAMATRKIAPALAAGCT
VVIKPATLTPLTTLFFAQILQDAGVPAGVVNVVTTTNTGPVSERIISDPRLRKLSFTGST
PVGVKLLQQAAPGVLRTSMELGGNAPFVVFEDADLDKAVDGAMLAKFRNIGQACTAANRF
IVQRSVVEEFTRRVTERVQGMKIGRGTEEGVQIGPLIDDRAVDKAKTLVGDAVERGAKVT
TGGSPIDGPGTFFEPTVVSDVQPGSDILREEIFGPVLAIIPFDDEDDAVRLANDTEYGLV
SYVFTESLARGQRMIDKLETGMMGLNVGVVSNAAAPFGGWKQSGLGREGGDEGIHEYLQT
KYTLTANPYA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgcgcgagagcgagctgctggcatccgtacccaccggcctgttgatcaac
ggcgagtggcgcgcggcgacgggcggcaagaccgtcgccgtgaacgaccccgccaccggt
gaggtcatccacgagatcgccgacgccacggtcgacgacggagtggcggcgatggatgcc
gcggccgaggcgttcccgtcctgggcggcgacccccgcgcgggagcgcgccgagatcctc
cgccgcgcgttcgacctgctgcaggagcgcaaggaggacatcgcgctgctgatgacgctc
gagatgggcaagcccctcgccgaggcgcgcggcgaggtcggctacggcggggagttcctc
cgctggttcagcgaggtcaccgcgcacacccagggccgctacggcgcgaaccccgagggc
accggccgcatgatcgtcacgcagcaccccgtgggcccgtgctacctcatcaccccgtgg
aacttcccgctcgcgatggccacgcgcaagatcgcgcccgcgctcgccgccggctgcacg
gtcgtcatcaagcccgcgaccctcacgccgctcacgacgctgttcttcgcgcagatcctg
caggacgccggcgtccccgcgggtgtcgtcaacgtcgtcaccacgaccaacaccggcccc
gtctcggagcgcatcatctccgacccgcgcctgcgcaagctctcgttcaccggctccacc
ccggtcggcgtgaagctgctgcagcaggcggcgcccggggtgctccgcacctcgatggag
ctcggcggcaacgcccccttcgtcgtgttcgaggacgccgacctcgacaaggcggtcgac
ggggcgatgctcgcgaagttccgcaacatcggtcaggcgtgcaccgcggccaaccgcttc
atcgtgcagcgctcggtcgtcgaggagttcacccgccgtgtcaccgagcgcgtgcagggc
atgaagatcggccgcggcaccgaggagggcgtgcagatcggccccctgatcgacgaccgc
gcggtcgacaaggccaagaccctggtgggggatgccgtcgagcgcggcgcgaaggtcacc
accggcggctcgccgatcgacggccccggcacgttcttcgagccgaccgtcgtgtccgac
gtgcagccgggcagtgacatcctccgcgaggagatcttcggacccgtcctcgcgatcatc
cccttcgacgatgaggacgacgccgtgcgcctcgccaacgacaccgagtacggcctcgtc
tcgtacgtcttcaccgagtcgctcgcgcggggtcagcgcatgatcgacaagctcgagacc
gggatgatgggcctgaacgtcggcgtcgtctccaacgccgcggccccgttcggcggctgg
aagcagtccggcctcggccgcgagggcggcgacgagggcatccacgagtacctgcagacg
aagtacacgctcacggcgaacccctacgcctga

DBGET integrated database retrieval system