KEGG   Microbacterium testaceum: MTES_1455Help
Entry
MTES_1455         CDS       T01423                                 

Definition
(GenBank) predicted membrane protein
  KO
K01421  putative membrane protein
Organism
mts  Microbacterium testaceum
Brite
KEGG Orthology (KO) [BR:mts00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    MTES_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 ABC2_membrane DUF3533 Laminin_I FlgN V_ATPase_I CagA Spc7
Motif
Other DBs
NCBI-ProteinID: BAJ74419
UniProt: E8N8H4
LinkDB All DBs
Position
1545377..1547314
Genome map
AA seq 645 aa AA seqDB search
MKVPQMITAELRRLTSTRMSVIALIALLAVPILYGGLYLWANQDPYGNLSNVPVALVVDD
TGADVNGQQRNLGDEAAEQLLDSDTFEWHRVSSDAADAGLERGDFDFIVTLPADFTESVA
SLSSSFPRQADIELRTNDANNYLASTIGTQAVARIQASVAKKVVDEAGLSLLDALHTIRV
SLVDATNGATQLVDGLDTAKNGSSQLATGSATLADGSSQLADGTALLSSGANQLRDGTAQ
LRDGSAQVADGARQVAGGVDRIDDAARQVGTIAQEAAARLPEARTDIAKALADAGLSQAK
IDEILSRLDPVGERLSAANAKVQSTVDQINQLDDGANQVADGSASLATGAASAADGASTL
ADGAGTAASGAAQLRDGAAQLRDGASQLDSGIGQLSTGATQLRDGLASGVQQIPDSDDAT
RKAQAQAISDPVSVGTSAVTKAQNYGAGLAPFFAALAGWIGIYALFLIVKPVSKRAITAL
RSPVRVTLAGWLTPAGLGALQMVGLFTVLAIALQFSFANPWAALGILLFASATYAAIVLA
LNVWLGSVGQFLGLVLMVLQLVTAGGTFPWQTLPAPLAALHHVLPMGYVVDAMRQVMYGG
DVSRVGPDLLVLGAWMLGGVALAALGVTRMTHHRTLRDLQPSLIG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcccgcagatgatcaccgcggagctccgccgcctcacctcgacgcgcatgtcg
gtgatcgccctgatcgccctcctcgcggttccgatcctgtacggaggtctctacctctgg
gcgaaccaggatccgtacggaaacctctccaacgtgccggtcgccctcgtcgtcgacgac
acgggtgccgatgtcaacggccagcagcgcaacctcggcgacgaagccgccgagcagttg
ctcgacagcgacacgttcgagtggcaccgcgtctcctccgacgccgcggatgccggactc
gagcgcggcgacttcgacttcatcgtgacgctcccggcggacttcaccgagtccgtggca
tccctgtcgagttcgttcccgcgacaggccgacatcgagctgcgcacgaacgatgcgaac
aactacctcgcctcgacgatcggcacgcaggcggtcgcgcgtatccaggcctccgtcgcg
aagaaggtcgtcgatgaagcgggactctcgctgctcgacgcccttcacacgatccgggtg
agtctcgtggatgccacgaacggggcgacgcagctcgtcgacggcctcgacacggcgaag
aacggctcgtcgcagctcgctaccgggtcggcgaccctcgccgacgggtcgtcgcagctg
gcggacggcacggcgctgctgtcgagcggcgcgaaccagctgcgcgacgggacggcgcag
ctgcgcgacgggtcggcgcaggtcgccgatggtgcacgtcaggtcgccgggggcgtggac
cgcatcgacgacgcggcccgccaggtcggcacgatcgcccaggaggcggcggcacgactg
cccgaagcgcggacggacatcgccaaggccctcgccgacgcggggctgagccaggccaag
atcgacgagatcctgtcgcggctggaccccgtcggcgagcgcctcagcgccgcgaacgcc
aaggtgcagagcacggtcgaccagatcaaccagctcgacgatggtgcgaaccaggtcgcc
gacggcagcgcctccctggccaccggagccgcctccgcggccgacggagcctcgaccctg
gccgatggcgccgggaccgcggcatccggagccgcccaactgcgcgacggcgcggcccag
ctccgcgacggcgcgagccagctcgacagcggcatcggccagctctcgaccggcgcgaca
cagctgcgcgacgggctggcctcgggcgtgcagcagatccccgactccgacgacgcgacc
cgcaaggctcaggcccaggccatctccgacccggtgagcgtcggcacgagcgcggtcacc
aaagcgcagaactacggcgcgggcctcgccccgttcttcgcggcgctcgcgggctggatc
ggcatctacgcgctgttcctgatcgtgaagcccgtgtcgaagcgcgcgatcacggcgctg
cgctcccccgtccgcgtgaccctcgcgggctggctcacgcccgcgggcctcggtgctctg
cagatggtcgggctcttcaccgtcctcgccatcgccctgcagttctcgttcgcgaatccg
tgggctgccctcggcatcctgttgttcgcctccgcgacctacgcggcgatcgtgctggcc
ctgaacgtctggctcggatcggtggggcagttcctcggactcgtcctcatggtgctgcag
ctcgtgacggccggcggaaccttcccctggcagacgctccccgcacctctcgcggcactg
caccacgtgctgccgatgggatacgtggtggatgccatgcgccaggtcatgtacggcgga
gacgtctcacgcgtcgggcccgatctgctggtgctgggcgcgtggatgctcggcggagtg
gccctggcagcgctgggagtgacgcgcatgacgcaccaccgcaccctgcgcgacctgcag
ccgagcctgatcggctga

DBGET integrated database retrieval system