KEGG   Microbacterium testaceum: MTES_2509Help
Entry
MTES_2509         CDS       T01423                                 

Definition
(GenBank) ABC-type transport system
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
mts  Microbacterium testaceum
Pathway
mts02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mts00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MTES_2509
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mts02000]
    MTES_2509
Transporters [BR:mts02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    MTES_2509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 NTPase_1 AAA_16 AAA_18 AAA_29 APS_kinase AAA_22 RuvB_N AAA AAA_33 AAA_30 T2SSE LapA_dom AAA_24 NACHT IstB_IS21 TsaE Rad17 PRK
Motif
Other DBs
NCBI-ProteinID: BAJ75473
UniProt: E8N6V9
LinkDB All DBs
Position
complement(2722642..2724336)
Genome map
AA seq 564 aa AA seqDB search
MNARVRGILRSAMPSRRRFAPAVLSGFGTALSAVALLAASAWLIARAAEQPLVMYLSAAV
VGVRAFALSRGVFRYLERLTSHDAALHQLAGVRADLVRELVPLAPDGLGRAERGGLLSSV
VDDVEELQNLPLRVVLPLSSAVLTSLAAVVFTAFISWPAALVLLGCLVVAFAVAVAVGWV
AGARAERSVAPLRAAVADAVHDLLTNLDVLTAYGALDAARERIRSADAALRRALVRRGVA
QGLTSGTVSVLAGAASLLALAVAAPGVTGGTLSGPGLAVVVLLPMAVFEVFGPVPLALAS
WRQVRAAAERIADAVPESIPDGLPREDPAPTGVGPSLGDGLVLRGVAAHWPARSDTDGDA
GRLDDVDLRVGPGERVLVTGPSGAGKTTLAHVLVRFLDYAGSYTVGGVEARDLSGDDLRR
TVGLIEQAPFLFDESVRQNLLFARDSATDGDLWAVLARVGLDGWVRERGGLDARVGDRGV
LVSGGQAQRLALARALLRGFPVLVLDEPTAGVDPAASEALLHDLLGAVDRERAVVLVSHV
EVPAGLVDREVRMEDGRIVASSRS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcccgggtgcgcggcatcctgcgctccgcgatgccctcgcgtcggcggttcgcc
cccgcggtgctctcgggcttcggcacggcgctcagcgccgtcgcgctcctcgcggcgagc
gcgtggctcatcgcgcgggcggcggagcagccgctggtgatgtatctgtccgcggcggtc
gtcggcgtgcgggccttcgcgctgtcgcgcggggtcttccgctatctcgagcggctgacc
agccacgacgccgcgctgcaccagctcgccggagtgcgtgcggacctcgtccgagagctc
gtgcccctcgccccggacgggctcggacgcgcggagcgcggcggtctgctgtcgagcgtg
gtcgacgacgtcgaggagttgcagaaccttcccctccgcgtggtcctccccctctcgtcc
gccgtgctgacctcgctcgccgccgtcgtgttcacggcgttcatctcgtggcccgccgcc
ctcgtgctcctcgggtgcctcgtcgtcgcgttcgcagtggccgtcgcggtcgggtgggtc
gcgggcgcgcgcgccgaacgctcggtcgcaccgctgcgcgccgcggtcgcggacgcggtg
cacgaccttctgacgaacctcgatgtgctgaccgcctacggggctctggatgccgcgcgc
gagcgcatccgttcggccgacgccgctctgcgccgggcgttggtgcgccgcggtgtcgcc
cagggcctcacctccggcacggtctcggtgctcgccggcgccgcctcactcctcgccctg
gcggtcgcggccccgggagtcaccggcggaaccctctcgggcccggggctggcggtcgtc
gtgctgctgccgatggcggtgttcgaggtgttcgggccggttcctctcgccctggcatcc
tggcgccaggtgcgcgccgccgccgagcggatcgccgacgcggtgcccgagagcatcccc
gacggcctgccgcgggaggaccccgcgcccaccggtgtcggcccctcgctcggcgacggt
ctggtgctgcgcggcgtggccgcgcactggcccgcccgcagcgacaccgacggcgacgcc
ggacgcctcgacgacgtcgatctacgcgtcggcccgggcgagcgggtgctcgtcaccgga
ccgagcggcgcgggcaagacgacgctcgcgcacgtgctcgtgcgcttcctcgactacgcg
gggtcgtacacggtcggcggcgtcgaagcgcgggacctctccggcgacgacctccgccgg
acggtcgggctcatcgagcaggcgccgttcctcttcgacgagtcggtgcggcagaacctg
ctcttcgcgcgggactccgccaccgacggcgacctgtgggcggtgctcgcgcgggtcggg
ctcgacgggtgggtccgcgagcgcggcggcctcgacgcccgcgtcggcgaccggggcgtc
ctcgtctcgggcggccaggcgcagcgtctcgccctcgcccgggcgctcctgcgcgggttc
ccggtgctcgtgctcgacgagccgaccgcgggcgtggacccggcggcatccgaggccctc
ctccacgatctgctgggtgcggtcgatcgcgagcgagccgtggttctcgtgtcgcacgtc
gaggtgccggcgggactcgtggaccgcgaggtgcggatggaggacgggcggatcgtcgcg
tcgtcgcggtcctga

DBGET integrated database retrieval system