KEGG   Microbacterium testaceum: MTES_2568Help
Entry
MTES_2568         CDS       T01423                                 

Definition
(GenBank) threonine dehydrogenase
Organism
mts  Microbacterium testaceum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C Pyr_redox_2 Pyr_redox Pyr_redox_3 HI0933_like TrkA_N NAD_binding_8 AdoHcyase_NAD 3HCDH_N 2-Hacid_dh_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAJ75532
UniProt: E8N7A0
LinkDB All DBs
Position
complement(2776011..2777033)
Genome map
AA seq 340 aa AA seqDB search
MLTAAYVGEHTIDVREADATPPGPGQVQIRVAYTGLCGTDLHILHGSMDARVQTPLVFGH
EMSGTIASLGEGVEGWDVGNGVTVMPLAWDGTCPACLAGNQHICQNLDFIGIDSPGSLQG
LWNVPAETLVRLPEGIALDHAALVEPVAVAVHDVRRAELAPGDKAVVIGGGPIGVLIACV
ARHTGADVLVIELDEKRRAQIEELGFATLDPRERDQVAVVEEWTRGAGADVVFEVSGAAA
AVRGATGLAKVRGTIVVVAIHPTPREVDLQRMFWRELRLLGARVYQRPDFETAVELVADG
VIPTDLLITRIVPLSATAEAFADLEAGRAMKILVDVGGQA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctgacagcggcctacgtgggcgagcacacgatcgacgtccgagaagcggatgccacc
cctcccggccccggtcaggtccagatccgcgtggcctacacgggcctctgcgggacggac
ctgcacatcctgcacgggtcgatggacgcgcgggtgcagaccccgctcgtcttcggacac
gagatgagcggcacgatcgcctcgctcggcgagggcgtcgagggatgggacgtcggcaac
ggcgtcacggtgatgccgctcgcgtgggacggcacgtgccccgcctgcctggccggaaac
cagcacatctgccagaacctcgacttcatcggcatcgactcccccggctcgctgcagggc
ctgtggaacgtgcccgccgagacgctcgtccgtctgcccgagggcatcgcgctggaccac
gccgcgctcgtcgaaccggtcgcggtcgccgtccacgacgtgcggcgcgccgagctcgcc
cccggcgacaaggccgtcgtcatcggcggcggccccatcggcgtcctcatcgcctgcgtc
gcccggcacaccggcgccgacgtgctcgtgatcgagctcgacgagaagcgccgcgcgcag
atcgaggagctcggcttcgcgaccctcgacccccgcgagcgcgaccaggtcgcggtcgtc
gaggaatggacccggggcgccggagccgacgtcgtgttcgaggtctcgggcgccgcggcc
gccgtccgcggagcgaccgggctggcgaaggtgcgcggcacgatcgtcgtcgtggcgatc
caccccaccccgcgcgaggtcgacctccagcgcatgttctggcgcgaactgcgcctgctc
ggcgcacgcgtctaccagcgtcccgacttcgagaccgccgtcgaactcgtcgccgacggc
gtgatccccacggacctgctcatcacccggatcgtgcccctgagcgccaccgccgaggcc
ttcgccgacctcgaggcgggtcgtgcgatgaagatcctcgtcgacgtgggaggccaggca
tga

DBGET integrated database retrieval system