KEGG   Microbacterium testaceum: MTES_2568
Entry
MTES_2568         CDS       T01423                                 

Definition
(GenBank) threonine dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mts  Microbacterium testaceum
Pathway
mts00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MTES_2568
Enzymes [BR:mts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MTES_2568
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MTES_2568
    1.1.1.-  
     MTES_2568
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Pyr_redox_2 AlaDh_PNT_C Pyr_redox Pyr_redox_3 HI0933_like TrkA_N NAD_binding_8 DAO AdoHcyase_NAD 3HCDH_N UDPG_MGDP_dh_N 2-Hacid_dh_C NAD_binding_7
Other DBs
NCBI-ProteinID: BAJ75532
UniProt: E8N7A0
LinkDB
Position
complement(2776011..2777033)
AA seq 340 aa
MLTAAYVGEHTIDVREADATPPGPGQVQIRVAYTGLCGTDLHILHGSMDARVQTPLVFGH
EMSGTIASLGEGVEGWDVGNGVTVMPLAWDGTCPACLAGNQHICQNLDFIGIDSPGSLQG
LWNVPAETLVRLPEGIALDHAALVEPVAVAVHDVRRAELAPGDKAVVIGGGPIGVLIACV
ARHTGADVLVIELDEKRRAQIEELGFATLDPRERDQVAVVEEWTRGAGADVVFEVSGAAA
AVRGATGLAKVRGTIVVVAIHPTPREVDLQRMFWRELRLLGARVYQRPDFETAVELVADG
VIPTDLLITRIVPLSATAEAFADLEAGRAMKILVDVGGQA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgctgacagcggcctacgtgggcgagcacacgatcgacgtccgagaagcggatgccacc
cctcccggccccggtcaggtccagatccgcgtggcctacacgggcctctgcgggacggac
ctgcacatcctgcacgggtcgatggacgcgcgggtgcagaccccgctcgtcttcggacac
gagatgagcggcacgatcgcctcgctcggcgagggcgtcgagggatgggacgtcggcaac
ggcgtcacggtgatgccgctcgcgtgggacggcacgtgccccgcctgcctggccggaaac
cagcacatctgccagaacctcgacttcatcggcatcgactcccccggctcgctgcagggc
ctgtggaacgtgcccgccgagacgctcgtccgtctgcccgagggcatcgcgctggaccac
gccgcgctcgtcgaaccggtcgcggtcgccgtccacgacgtgcggcgcgccgagctcgcc
cccggcgacaaggccgtcgtcatcggcggcggccccatcggcgtcctcatcgcctgcgtc
gcccggcacaccggcgccgacgtgctcgtgatcgagctcgacgagaagcgccgcgcgcag
atcgaggagctcggcttcgcgaccctcgacccccgcgagcgcgaccaggtcgcggtcgtc
gaggaatggacccggggcgccggagccgacgtcgtgttcgaggtctcgggcgccgcggcc
gccgtccgcggagcgaccgggctggcgaaggtgcgcggcacgatcgtcgtcgtggcgatc
caccccaccccgcgcgaggtcgacctccagcgcatgttctggcgcgaactgcgcctgctc
ggcgcacgcgtctaccagcgtcccgacttcgagaccgccgtcgaactcgtcgccgacggc
gtgatccccacggacctgctcatcacccggatcgtgcccctgagcgccaccgccgaggcc
ttcgccgacctcgaggcgggtcgtgcgatgaagatcctcgtcgacgtgggaggccaggca
tga

DBGET integrated database retrieval system