KEGG   Microbacterium testaceum: MTES_3162Help
Entry
MTES_3162         CDS       T01423                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mts  Microbacterium testaceum
Pathway
mts03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mts00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    MTES_3162
Enzymes [BR:mts01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MTES_3162
DNA repair and recombination proteins [BR:mts03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MTES_3162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: BAJ76126
UniProt: E8NC83
LinkDB All DBs
Position
complement(3431222..3433699)
Genome map
AA seq 825 aa AA seqDB search
MVEQTVQIGGRRLRLSNLDKVLYPETGTTKGEVIDYYSRVAARLLPHVADRPVTRKRWPD
GVGTADAPGEPFFAKALEPGAPAWVRRFPIDHSSGAKDYPLVDDLPTLVSLAQVASLELH
VPQWRFSPDGERQNPDRLVLDLDPGPGVGLVECAEVARWARAILRDIGLDPLPVTSGSKG
IHLYAHLDGKQSSEAASAIAKELARAIEADHPDLVVSQMSKAARPGKVFIDWSQNNGSKT
TIAPYSLRGRAQPTVAAPRTWEELDDPALRHLLFTDVLERTGDPLAAVERETGPLRAYIS
KRTAGRTPEPVPEAPHGEPAPEGLPRFVIQEHHASRLHWDLRLEHGGVLVSWAVPKGIPS
TTAKNSLAVMTEDHPMQYLDFTGEIPRGEYGAGIMTVWDTGTYELEKWRDDEVIATLQGR
DDGPLGRVRVALIRTEGRGEKSQWLLHRMKTDAEGRPQADGAPVVALDHGRVGRDPEPRG
AAAGHADGDVDAPDGSRRGAPSPADVRPMLATSATPGLARAAAGRWGQAWVEMKWDGIRG
IGLWDGRRLRLRSRNGNDLTAAYPELTTVDLGLGPEPAIIDGEIVALDPQGRPSFPLLQK
RMNLAQPREIEREARRTPVHLYLFDVLSVGDRDVSPLPLAERRGILESLAQKATAPVVIP
PVFDDVDAAVATSGRFGLEGVVVKDPRSPYRRGERSEQWLKVKHSRTQEVVVGGVRPGKG
NRAGTIGSLLVGVPDPDGLRYAGRVGSGFSEQTLARLSELLAPLGSDADPFVGVPAADAR
DAIWVRPELVAEVEFAEFTPDGILRQARWRGLRPDKDPSEVVREG
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggtggagcagacggtgcagatcggcggtcgtcgactgcggctgtccaatctcgacaaa
gtcctgtaccccgagaccgggaccaccaagggcgaggtgatcgactactactcccgcgtc
gcggcgcgtcttctcccccacgtcgccgaccgccccgtcacgcgcaaacggtggcccgac
ggcgtcgggaccgcggatgccccgggtgaaccgttcttcgccaaggctctggagccgggc
gctcccgcgtgggtgcgccgcttcccgatcgatcactcgtcgggggcgaaggactacccg
ctcgtcgacgaccttcccacgctcgtctccctcgcgcaggtcgcgagcctcgaactgcac
gtcccgcagtggcggttctcgcccgacggcgagcgacagaaccccgaccgtctcgtgctc
gatctcgaccccggtcccggcgtgggactcgtcgagtgcgccgaggtcgcccggtgggcg
cgggcgatcctccgtgacatcggcctcgaccccctccccgtcaccagcggcagcaagggc
atccacctctacgcgcatctcgacgggaagcagtcgagcgaagccgccagcgcgatcgcg
aaggagttggcgcgcgcgatcgaggccgaccaccccgacctcgtcgtcagccagatgtcc
aaagccgcgcgtccgggcaaggtcttcatcgactggagccagaacaacggctcgaagacc
acgatcgcgccgtactcgctgcgcgggcgggcgcagccgacggtcgcggctccccgcaca
tgggaggagctcgacgaccccgccctccgtcacctgctcttcaccgacgtgctcgagcgc
acgggcgaccccctcgccgcggtcgaacgcgagaccgggcccctgcgcgcgtacatctcg
aagcgcaccgccggccgcacgcccgaacccgtgcccgaagcaccgcacggcgagcccgcg
cccgagggcctcccccgcttcgtgatccaggagcaccacgcgtcccgcctgcactgggat
ctgcgcctcgaacacgggggcgtgctcgtcagctgggcggtgcccaaaggcatcccctcg
acgacagccaagaacagcctcgcggtcatgaccgaggaccacccgatgcaatacctcgac
ttcaccggcgagattccgcgcggagaatacggcgcgggcatcatgactgtctgggacacg
ggcacgtacgagctcgagaaatggcgcgacgacgaggtgatcgcgacgctccaggggcgc
gacgacggcccgctcgggcgcgtgcgcgtcgcgctgatccgcacggagggccgcggcgag
aagtcccagtggctgctgcaccggatgaagacggatgctgagggccgcccgcaggcagac
ggcgcgcccgtcgtggcgctcgatcacggtcgagtcgggcgcgatccggaacctcgcggt
gccgccgctgggcacgccgacggcgatgtggacgcgccggacggttcccgccgcggcgcc
ccttcccccgccgacgtacgccccatgctcgcgacgtccgccacgccggggctggcgcgc
gcagccgccgggcggtggggacaggcgtgggtggagatgaagtgggacggcatccgtggg
atcggactgtgggacggccggcgcctacgcctgcgttcgcgcaacggcaacgacctcacc
gcggcgtatcccgagctcacgacggtcgacctcggtctcggccccgagcccgcgatcatc
gacggcgagatcgtcgccctcgatccgcagggacggccgagcttcccgctgctgcagaag
aggatgaacctggcccagccccgcgagatcgagcgggaagcccgccgcacccccgtgcac
ctgtacctgttcgatgtcctcagcgtgggagaccgcgacgtctcgcccctccccctcgcc
gagcgccgcggcatcctggagtccctcgctcagaaggccacggcccccgtcgtcattcca
cccgtgttcgacgacgtggatgccgccgtcgccacgagcggtcgattcgggctcgagggg
gtcgtcgtgaaggacccgcgttctccctaccgccgcggcgagcggtcggaacagtggctg
aaggtcaagcattcgcgcacgcaggaggtcgtcgtcggcggtgtgcgcccggggaagggc
aaccgtgcgggcacgatcgggtcgctgctcgtgggcgtgcccgacccggacggactgcgc
tacgccggccgcgtcggctcgggcttctcggagcagacgctggcgcgcttgagcgagctc
ctcgcgccgctcggcagcgacgcggatccgttcgtcggcgttccggcggccgacgcccgc
gacgcgatctgggtgcgccccgagctcgtcgccgaggtggagttcgcggagttcacgccg
gacggcatcctgcgtcaggcgcggtggcgggggctgcggccggacaaggatccgagcgag
gtcgtgcgggagggctga

DBGET integrated database retrieval system