KEGG   Microbacterium testaceum: MTES_3235Help
Entry
MTES_3235         CDS       T01423                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mts  Microbacterium testaceum
Pathway
mts00473  D-Alanine metabolism
mts00550  Peptidoglycan biosynthesis
mts01100  Metabolic pathways
mts01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mts00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MTES_3235 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MTES_3235 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MTES_3235 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mts01011]
    MTES_3235 (ddl)
Enzymes [BR:mts01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MTES_3235 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:mts01011]
 Precursor biosynthesis
  Amino acid ligase
   MTES_3235 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: BAJ76199
UniProt: E8NCW9
LinkDB All DBs
Position
3506820..3507905
Genome map
AA seq 361 aa AA seqDB search
MTKPVVVVLFGGRSSEHSISSATAGGVLRAIDRDRFRVIPVGITRDGAFVLEDDDPDKFA
LIPEALPQVVDNGTRVRLPDSTLTREWTVTDAEGTWSLGDVDVVLPILHGRFGEDGTVQG
LLELLGIPYAGGGVLMSAIGMNKHVTKQVLRAANVPVVPWVAVSRADLARDRSLWERRIR
ALDLPVFVKPNEAGSSVGVTKVSRWEDLDAALDTAFAEDGLVLVEKAIVGRELECGVLPG
RDGGPVRVSVAGEIVVTGREFYDFEAKYLDAPGVDLVCPAELGDGELAEMQRIATQAFEA
IGGQGLARVDFFSTGTEFFVNEVNTMPGFTPISMFPTCWIASGLSYPDLISDLLDAALEK
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaccggtggtggtggtgctcttcggcgggcgctccagcgagcattcgatcagt
tccgccacggcgggcggggtgctgcgcgcgatcgatcgtgaccgcttccgggtgattccg
gtcgggatcacccgcgacggcgccttcgtcctcgaggacgacgaccccgacaagttcgct
ctcatccccgaggcgctgccgcaggtcgtcgacaacggcacgcgcgtgcgacttcccgac
tcgacgctcacgcgcgagtggacggtgacggatgccgagggcacgtggtccctcggcgac
gtcgatgtcgtcctgccgatcctgcacggccgcttcggcgaggacggcacggtgcaggga
ctgctcgagctcctcggcatcccgtatgccggcggcggcgtgctcatgtcggcgatcggc
atgaacaagcacgtgaccaagcaggtgctccgcgccgcgaacgtccccgtcgtgccgtgg
gtcgcggtgagccgcgccgacctcgcccgcgaccggtcgctgtgggagcggcgcatccgc
gccctcgacctgccggtgttcgtcaagccgaacgaggccggctcgagcgtcggcgtcacg
aaggtgtcgcgctgggaagacctcgatgccgccctcgacaccgctttcgccgaggacggt
ctggtgctcgtggagaaggcgatcgtcgggcgtgagctcgagtgcggggtcctgcccgga
cgcgacgggggaccggtgcgcgtgtccgtcgcgggcgagatcgtcgtgacgggccgcgag
ttctacgacttcgaggcgaagtatctcgacgctccgggcgtcgacctcgtgtgccccgca
gagcttggcgacggcgaactggccgagatgcaacgcatcgccacgcaggccttcgaggcg
atcggcggtcaggggctggcccgggtggacttcttctccaccggcaccgagttcttcgtg
aacgaggtcaacacgatgcccgggttcacgccgatctcgatgttcccgacgtgctggatc
gcgtcgggcctgagctaccccgacctgatcagcgacctgctcgacgcggcgctcgagaag
gcctga

DBGET integrated database retrieval system