KEGG   Marivirga tractuosa: Ftrac_0743Help
Entry
Ftrac_0743        CDS       T01365                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00010  Glycolysis / Gluconeogenesis
mtt00020  Citrate cycle (TCA cycle)
mtt00620  Pyruvate metabolism
mtt01100  Metabolic pathways
mtt01110  Biosynthesis of secondary metabolites
mtt01120  Microbial metabolism in diverse environments
mtt01130  Biosynthesis of antibiotics
mtt01200  Carbon metabolism
Module
mtt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ftrac_0743
   00020 Citrate cycle (TCA cycle)
    Ftrac_0743
   00620 Pyruvate metabolism
    Ftrac_0743
Enzymes [BR:mtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ftrac_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 QRPTase_N HlyD_3 Peptidase_M23 GCV_H E_Pc_C
Motif
Other DBs
NCBI-ProteinID: ADR20745
UniProt: E4TRZ4
LinkDB All DBs
Position
complement(927113..928801)
Genome map
AA seq 562 aa AA seqDB search
MAEVIKMPKMSDTMEEGVIASWLVKEGDEVSSGDILAEVETDKATMELESYEDGVILHIG
IKEGDAVPVDGVIAIIGEKGEDIDGLLKEVENGGSSAKAEESSSEKEDKKSEQGSEEEID
ASDVNASLITMPKMSDTMEEGVIASWLKKEGDKVEAGDILAEVETDKATMELEAYEDGTL
LYIGIKEGDAAPIDGVIAVIGEEGADYKKLLKAHEQKSSGGGESKNEAKEEKKEKSEDKK
SSESKSDSGSPKPTPPVDAANKEKSGEGKGRIFASPLAKKIAKDKGIDLSEVEGSGGNGR
IIKSDVENFTPKQKSTEAAKQESSEQAMSIPQVVGEESYEEVKVSQMRKAVAKRLSESKF
TAPHFYVTMEINMDKAMEARKSINEVSPIKISFNDMVIKAVAASLRQHPKVNSSWMGDKI
RRNNHVHVGMAVAVEEGLLVPVIRFADNKSLSHIATEAKDFAKKAKSKELEPKDWEGNTF
TVSNLGMFGVEEFTAIINPPDACILAVGGIKQTAVVKDGELVPGNVMKVTLSCDHRVVDG
AVGSAFLQTLKGLLEDPVRILI
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtaataaaaatgcccaaaatgagtgacaccatggaagaaggtgtaattgcc
tcatggttggtaaaagagggcgatgaagtatcatcaggagatatattggctgaggttgaa
accgataaagccacaatggaattagagtcttatgaagacggagtaattttacacatcgga
ataaaagaaggggatgcagtgccagttgatggtgtaattgccatcataggtgaaaaagga
gaagatattgacggtttgttaaaagaagtcgaaaatggtggaagctctgcgaaagctgaa
gaaagcagttctgaaaaagaagataagaaatcagaacagggaagtgaagaagaaattgac
gcttcggatgtgaatgcaagcctaatcactatgccgaaaatgagtgataccatggaagag
ggagtgattgcctcatggttaaagaaggaaggtgataaagtagaagccggtgatatttta
gctgaggtggaaactgataaggcaaccatggaattggaagcttatgaagatggtactttg
ctatacatcggaataaaagaaggtgatgcggctccaattgacggagtcattgccgtaatc
ggtgaagaaggtgctgattataaaaaattgttaaaagctcatgagcaaaaatcttcaggt
ggtggagaaagcaaaaatgaagctaaagaagaaaagaaagagaagtctgaagataaaaaa
tcatctgaaagcaaatctgattcaggtagtcctaagccaaccccacctgttgatgctgca
aataaagagaagagtggtgaaggtaaaggcagaatttttgccagcccattggctaagaaa
atcgctaaggataaagggattgatttatcagaagtagaaggctctggtggtaatggcaga
atcattaaatcagatgttgaaaacttcactcctaagcagaaatctacggaagctgcaaaa
caagagtcttcagaacaggctatgagtattccacaagttgtgggagaagaaagctatgaa
gaggtgaaagtctctcagatgagaaaagcggttgccaaaagactttctgaaagtaagttt
accgctccgcacttctacgtgaccatggaaatcaatatggataaagccatggaagcaaga
aagagcattaatgaggtgagtccaattaagatatctttcaatgacatggtgattaaagca
gtggccgcttcactacgtcagcatccaaaggtgaacagctcatggatgggcgataaaata
agaagaaataatcacgttcatgtgggaatggcagtggcagtagaggaaggtctattagtg
cctgttatccgctttgctgataataaatcattatcgcatatagcaactgaagcaaaagat
tttgctaaaaaggcgaaaagtaaagaattagagccaaaagattgggaaggcaataccttt
actgtttccaatttaggaatgtttggagtagaagaatttacagcaattattaatccacct
gatgcttgtattttggcagtgggagggatcaaacaaactgctgtggtgaaagatggtgaa
ttggtgcctggaaatgtgatgaaagtaacgctttcttgcgatcatagagtggtagatgga
gcagtgggttctgcattcttacaaaccttaaaaggattgttggaagacccagtgagaata
ttgatttaa

DBGET integrated database retrieval system