KEGG   Marivirga tractuosa: Ftrac_0770Help
Entry
Ftrac_0770        CDS       T01365                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mtt  Marivirga tractuosa
Pathway
mtt03030  DNA replication
mtt03410  Base excision repair
mtt03420  Nucleotide excision repair
mtt03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mtt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Ftrac_0770
   03410 Base excision repair
    Ftrac_0770
   03420 Nucleotide excision repair
    Ftrac_0770
   03430 Mismatch repair
    Ftrac_0770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mtt03032]
    Ftrac_0770
   03400 DNA repair and recombination proteins [BR:mtt03400]
    Ftrac_0770
Enzymes [BR:mtt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Ftrac_0770
    6.5.1.6  DNA ligase (ATP or NAD+)
     Ftrac_0770
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Ftrac_0770
DNA replication proteins [BR:mtt03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Ftrac_0770
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Ftrac_0770
DNA repair and recombination proteins [BR:mtt03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Ftrac_0770
   NER (nucleotide excision repair)
    Other NER factors
     Ftrac_0770
   MMR (mismatch exicision repair)
    Other MMR factors
     Ftrac_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ADR20772
UniProt: E4TS21
LinkDB All DBs
Position
954460..956061
Genome map
AA seq 533 aa AA seqDB search
MKEFAQLITSLDQSNKTNDKVNALKNYFLSANDQDKIWTLALFTHRKPKRTVNTNLLKDW
VTEWTGIPEWLFQESYQVVGDLAETISLLVASTDEGYKEVDNLLSYYIKTLISLRDKSIE
EKKKRLQSIYKELDPQERFVFTKIMTGGWRVGVSQNLITKALSEAFDIDKSIIAHRLMGN
WSPENFTFQELILEESKNDLASRPYPFYLAHPIETQEIQEELNPAEWQAEWKWDGIRGQI
IKRNDEVFIWSRGEELVTEKFPELVEMAEKLPNGAVLDGEITAYRNGEPLSFGVLQTRIG
RKNITKNLIKKAPVVFICYDIIEHKGKDIRTKALSYRTQLLNQLLLEIDHPILLASQSIE
FSDWVELIEIRKKSRSLKTEGLMLKKKNSIYEAGRKRGSWWKWKIAPLTIDGVMIYAQKG
HGRRADLYSDYTLAVWNEDELIPFAKAYSGLTDAEMKKVDAFVKKNTKEKFGPVRTVKPE
LVFEIAFEGIQVSNRHKSGIALRFPRIKRWRQDKPISEANKLTDLQHLLEKYG
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaatttgcacaacttataacatctctcgaccaaagcaataaaaccaatgacaag
gttaatgctttaaaaaattattttttatcagccaacgatcaagataaaatctggaccttg
gctctattcactcatcgtaaaccaaaaagaacggtcaatactaatttacttaaagactgg
gtcaccgagtggacaggtattcctgaatggctttttcaggaatcctatcaagtagtgggg
gatttagctgaaactatttcacttttggtagcttccactgatgaaggctataaggaagtt
gacaatcttctctcctactatataaagactttaattagccttagagataaaagtatagaa
gagaaaaaaaagcgacttcaaagtatctataaagaattagatccacaagaaagattcgtt
tttactaaaattatgacaggtggatggcgagtgggtgtctcacaaaaccttattaccaaa
gctttaagtgaagcatttgacatagataaatcgataattgcacatcgattaatgggcaat
tggtcaccagagaatttcacttttcaagaactgattctggaagaaagtaaaaatgactta
gcttcacgcccttaccctttttatttagctcatccaatagaaactcaggaaatccaagag
gagctaaatcctgcagagtggcaagcggaatggaaatgggatggaatccgggggcaaatc
attaaaagaaatgatgaagtcttcatctggagcagaggagaagaattagtgacggaaaaa
ttccctgaacttgtcgaaatggccgaaaaactacccaatggagcagttctggatggtgaa
attacagcttatcgtaatggagagccattatcctttggcgtactgcaaactagaattgga
aggaaaaacattaccaaaaacctaataaaaaaagctcctgtagttttcatctgctatgat
ataattgaacataaaggaaaagacataaggactaaggccttatcatatagaacccaactt
ttaaatcagcttctattagaaatagatcatccaattctcttagcttcacaaagcattgaa
ttttctgactgggtagaattaattgaaattcgaaaaaaatccagaagcctgaaaacagaa
ggcctaatgctcaagaaaaaaaactccatttatgaagcgggtagaaaaagaggaagttgg
tggaaatggaaaattgccccgctaacgattgatggcgttatgatttacgcccaaaaagga
cacgggagaagggctgatttgtattctgattacacactggcggtatggaatgaggatgaa
ttaataccctttgcaaaagcctattcaggtctgacagatgctgaaatgaaaaaagtggat
gcgttcgttaagaaaaatacaaaagagaaatttggtcctgttagaactgtaaaacccgaa
ctagtatttgaaatcgcatttgaaggtattcaagtctctaatcggcataaatcaggtatc
gctcttcgctttccacgaataaaaagatggcgtcaagacaaaccgatttcggaagccaat
aaattaaccgatctgcaacatctcttggaaaaatatggataa

DBGET integrated database retrieval system