KEGG   Marivirga tractuosa: Ftrac_2246Help
Entry
Ftrac_2246        CDS       T01365                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00240  Pyrimidine metabolism
mtt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ftrac_2246
Enzymes [BR:mtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Ftrac_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ADR22225
UniProt: E4TVX7
LinkDB All DBs
Position
complement(2654013..2654591)
Genome map
AA seq 192 aa AA seqDB search
MFVEPHIGREEGGKGKGWIELICGSMFSGKTEELIRRLNRALIAKQKIEIFKPKLDTRYD
ESEVVSHNKTKIRSTPVDFAEDILLFSGNSEVVGIDEAQFFDAEIVNVVNTLADQGKRVI
IAGLDMDFSGKAFGSMPELMAIAEYVTKVHAICVKCGGIASYSYRLSEEKQKVMLGEKDK
YEPRCRKCFNAP
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtagaaccacatataggaagagaagaaggcggtaaggggaaaggttggatagaa
ctgatttgtggttctatgtttagcggaaaaacagaagagcttatccgaaggcttaaccga
gcgcttatagccaagcaaaaaatcgaaattttcaagcctaaactagatactcgctacgat
gaatccgaagtggtttcgcacaacaaaaccaaaattcgatctactcctgttgatttcgca
gaagatattttattgttctcaggaaattctgaagtagtaggcattgatgaagctcaattt
tttgatgcagagattgtgaatgtagtaaatactttagcagatcaaggaaaaagagtcatc
atagcaggtttggatatggattttagcggaaaagcatttggatctatgcctgaattgatg
gctattgcagaatatgtcactaaggtgcacgccatctgcgtaaaatgtggaggtattgcc
tcctactcttaccgcttgagcgaagaaaaacaaaaagtgatgttgggggaaaaggataaa
tatgagcctaggtgtaggaagtgttttaatgccccctag

DBGET integrated database retrieval system