KEGG   Marivirga tractuosa: Ftrac_2381Help
Entry
Ftrac_2381        CDS       T01365                                 

Definition
(GenBank) hypothetical protein
Organism
mtt  Marivirga tractuosa
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2976
Motif
Other DBs
NCBI-ProteinID: ADR22359
UniProt: E4TMA0
LinkDB All DBs
Position
complement(2813673..2817074)
Genome map
AA seq 1133 aa AA seqDB search
MSENYHIAEILKKLKEYKRKYYVNKLIKGLLISLAIFLFVLITASWLEYKLQMSSISRTI
VFIVVGITLIYFVTRYIFLPIYHLLTNGKALSDKQAALEIGKYFPEIDDKLLNIIQLKEL
SSRQNSLIAASIIQKSEKISILNFKDSISLKSTNASYLPYVAIPAIIISLMLMFAPYMIT
EGSYRIIKFNEDFVPKAPFKFSIHNEELKAFKGENFTIRAELTGEELPAELFIQKEEVKQ
KFEKLSNSRFQFNLKNLQKDMKFQLEAAGFKSAEYELKVFEKPRIQNMNISLDYPDYVGT
SSERIINSGNLIIPEGTKAEWLIQSASSDRITIELLDDSLSFEKVNENTFRLQKNLTQSG
YYKLHLFNSEANYNEIIDYSVEVIKDKYPDITLNPINDSIYFSQVAIAGEISDDYGFSRL
QLIYTKRKGNNIVGTGKIPLSFNTQVRNQKYFKVWKVDSLLNEEGTVLDYYVQVADNDGI
NGAKISKSSTYQFKLPDEAKIQKEIENTSQSAENQLDRNIKASERTNQKLEELERILKGK
RNLNWEDKKLLEEILKEQERRKKELEKIKRELEKNQAKRDRFNKNDPDLREKSEQLESLM
EEMLKDENEELMEKIKSLLEEQNQSDEFRESVEDLKKQEKNKLKEMERMMELFKRMEIQY
DMKQVGESLKELEKEQKELAEENQSKDHNKSEELNDPNSDQNQSDNEQFSSEEEKQKALD
EQKRVNEEFEKIQEDLREIEKRNQSLKQPNQLKDTKEQETEIDLQQQNSLQKIQENNKSG
ASEQQKKSAEEMKKMSEMLSSMQMGMEMEMLQENIDDLKDIVDNLLKLSFRQEELMNNFK
QVNPSDPRFITLSEKQLAMQDDAKIIEDSLTTLAQRVFQLESFITKEMDKMNEAMQSSIE
ALRERDNGIAIGEQQFAMTSMNNLALMLDDVLEQMQMQMQSSMGMGQQSQGNEQTPSLSE
MQKSLNQKTQELNEGQKQGRQFSEKLGELAGEQAKIRKMMEELEKQLGKEGQEGGEENGG
APGDISEEMEKIEEDLVNKRLDRRLIERQQQIVTRLLESEKAREEQEEKDERKGETATEY
ERERIPNAFEEYIKEKEKEIEQLRNVPPNFSPYYKNEINKYYNRLKSKENLLR
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaaattaccatatagctgaaatccttaaaaaactcaaagagtacaaaaggaaa
tactatgtcaacaaactaataaagggtttattgatcagcttggctatatttcttttcgtt
cttataactgctagttggcttgaatataagttacaaatgagcagtatttccaggactatt
gttttcatagtagtcggtataactttaatatattttgtaacacgatacatattccttcct
atttatcatttgttgactaacggaaaagccttgagcgataaacaggccgccctagaaatc
ggaaaatattttcctgaaattgatgataaactactgaatatcattcagttaaaagaatta
agtagtcgacaaaacagcttgattgcagctagtataattcagaaatccgaaaaaatatcc
atactgaatttcaaggacagtatcagtcttaaatcaacaaatgctagctatctaccttat
gtggctattccagctattattataagcttaatgctaatgtttgctccttacatgattaca
gaaggaagctacagaatcattaaattcaatgaagactttgttccaaaagcaccatttaaa
ttttccatacacaatgaagaattaaaggcctttaaaggagaaaatttcacaattagggca
gaattaactggtgaggaattacctgctgaacttttcatacaaaaagaagaggtcaaacaa
aaatttgaaaagctaagcaacagccgttttcagttcaacttaaaaaacctccaaaaagat
atgaaattccagcttgaagctgctggattcaaatcagctgaatacgaattaaaagttttt
gaaaaaccgagaattcagaacatgaacatcagcttggattatcctgattatgtaggtaca
tcttcagaaagaataattaactcaggaaatttgattataccagaaggaacgaaagcagaa
tggttaatccaaagtgcctcgagtgacagaattactattgaattgcttgatgacagtctt
tcttttgaaaaagttaacgagaatacttttagactgcaaaaaaacctaactcaatccggt
tattacaaattgcatttatttaattctgaagctaattataatgaaattatagactattca
gttgaagtaattaaagataagtatcctgatataaccttgaatccaattaatgacagtatc
tattttagtcaagtagcaattgcaggagagatcagtgatgattatggattttctagatta
caattgatttacaccaaaaggaagggtaataatattgttggaaccggaaaaattccattg
tcctttaatactcaagttagaaaccaaaaatatttcaaagtttggaaagttgactctttg
ctaaacgaagaaggaactgttttagattattacgttcaagttgctgacaatgatggaata
aatggggctaaaatttctaaaagttcaacctatcaatttaaattaccagatgaagcaaag
attcagaaagaaatagaaaatactagtcaaagtgctgaaaatcaactagatagaaacatt
aaagcctctgaaagaactaatcaaaaactagaagaattagagcggatacttaaaggcaaa
agaaatttaaactgggaagacaaaaagcttttagaagaaattcttaaggaacaagagcgg
agaaaaaaggagcttgaaaaaattaaaagagaattagaaaaaaaccaagcaaaaagagat
cgttttaataaaaatgatcctgacttaagagagaaatccgagcaattagaaagcttaatg
gaggaaatgctcaaagatgagaatgaggagctaatggaaaaaataaaatctctcttggaa
gaacaaaaccaatccgatgaattccgtgaatctgtagaagaccttaaaaaacaagaaaag
aacaagcttaaggaaatggaacgtatgatggaactctttaaaagaatggagattcagtac
gacatgaagcaagtaggagagagcctcaaggaattagaaaaagagcaaaaagaattagct
gaagaaaatcaatcaaaagatcataataagtctgaagaattaaatgatcctaattcagat
cagaatcaatccgacaatgaacagttttcttctgaagaggaaaagcaaaaagctttagat
gaacaaaaaagagttaatgaagaatttgaaaaaattcaagaggacttaagagaaatcgaa
aaacgtaatcagtctttaaagcaacccaaccaattaaaagatacgaaagagcaagaaact
gagattgacttgcagcagcaaaacagcctgcaaaaaattcaggaaaacaataaaagtggg
gctagtgagcaacaaaagaaatcagctgaggaaatgaaaaaaatgtctgaaatgctttct
tcaatgcaaatgggcatggaaatggaaatgctgcaagaaaacatagacgatttaaaagat
attgtagataatctgctaaaactttccttcagacaggaagaactgatgaacaactttaag
caagtaaatcctagtgatccccgctttataacattatcggaaaaacagttagcgatgcaa
gatgatgcaaaaatcattgaggacagtcttactacccttgctcaaagagtttttcaacta
gaatcctttataacaaaggaaatggataaaatgaatgaggccatgcaaagcagtatagaa
gccttacgagaaagagataacgggattgccataggagaacagcaatttgccatgacttca
atgaacaaccttgcccttatgttagacgatgtattagaacagatgcagatgcaaatgcaa
tcttcaatgggcatgggtcaacaatcccaaggcaacgagcaaaccccaagcctttctgaa
atgcaaaaatccttaaatcaaaaaacccaagagcttaatgaaggacaaaagcaaggcagg
caattttcggagaagcttggcgaattagcaggagagcaagctaaaattaggaaaatgatg
gaggagcttgaaaagcaattaggaaaagaagggcaagaaggaggtgaggagaacggagga
gctccaggtgatatttctgaggaaatggaaaagatagaggaagatctagtaaataaaagg
ctggatcgaagattaatagaaagacaacaacaaattgttactaggttgttggagtcagaa
aaagcaagagaagaacaagaagaaaaggatgaaagaaaaggagaaactgctacagaatat
gaacgtgagcgaatccctaatgcttttgaagagtatataaaagaaaaggaaaaagaaatt
gagcagctaagaaatgtgccgccaaatttctcgccttactataaaaatgaaattaataag
tattataatcgattaaaatctaaagaaaacctattacgatga

DBGET integrated database retrieval system