KEGG   Marivirga tractuosa: Ftrac_3278Help
Entry
Ftrac_3278        CDS       T01365                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00620  Pyruvate metabolism
mtt00680  Methane metabolism
mtt01100  Metabolic pathways
mtt01120  Microbial metabolism in diverse environments
mtt01200  Carbon metabolism
Module
mtt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mtt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ftrac_3278
  09102 Energy metabolism
   00680 Methane metabolism
    Ftrac_3278
Enzymes [BR:mtt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Ftrac_3278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 LuxQ-periplasm
Motif
Other DBs
NCBI-ProteinID: ADR23252
UniProt: E4TW34
LinkDB All DBs
Position
3851204..3853759
Genome map
AA seq 851 aa AA seqDB search
MKKLKYKDEVATRYTAYNSLFLDLPYDHIYRTGTLLPILEQLSTQGFENGKDPVEIINQF
KREILGDKEEKQLHQLLFQLIQYVERQVLLFDSIEDAAFEKIFNVEGKGSVKELIGRVRH
TNKIEELQEKLKTFSVRIVLTAHPTQFYPGNVLAINTDLEDAIRKDDLASINSLMLQLGK
TPFINKEKPTPYDEAVSLCWYLENVFYKSIPAIIYDLVEELEEPWEDWVNPDLLTVGFWP
GGDRDGNPFVTHNITVKVADRLRETILKCYYRDLRAIRRRLTFKGVENKILEAEQHVYNA
LYGDKSKGFKQPEELIDVLREALHNLRNEHKGIFSELLEKFILKVRIFGFHFSIMDIRQD
SRKHDALWEDILSNEDDKSIVAQYEKMQEEDKINHLLSFNSLPHDVSIYNDFHQEMLKSF
DALEEVKKRNGHRACHRYIISNCQSALHVMEVFQLARLKLSSDAYESLDIVPLFETIDDL
ANASGVMKQLYEIPAYREHVKNRGDKQTIMVGFSDGTKDGGYLRANWSIFQAKEALTEIS
REYGIKVIFFDGRGGPPARGGGNMHDFYASLGSKIEDEEVQVTIQGQTISSNYGKVGSCR
YNMEQLLSAGLENHLFESDNRMLNEEERELLSQLAEIAYQLYKDFKGHDKFTSYLGDVTP
LKYFGDTNIGSRPTSRGKKGELKFEDLRAIPFVGAWAQMKQNIPGFYGVGTALHSLKSKG
KGKDVKQLYRDSLFFRTLLGNSMQSIAKSFYPATAYLSKDEDYGEFWQLMKKEFDLSKDE
LDDISGKKGILHEAPVSQASIAIREKIVLPLITIQQYAIQKLREGVKDEEIYKKLILRSM
FGIVNAARNAA
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgaaatacaaggacgaagtagccactcgatataccgcatataacagcctt
tttcttgatttaccttatgatcatatttacagaacgggtacattgctacctattctagag
caattaagtactcaaggttttgaaaatggaaaagatcctgtcgagattattaatcaattt
aaacgagagattttaggtgataaagaggagaaacagctgcatcaattgctatttcaattg
atccaatatgttgaaagacaagtgttgctttttgactctatagaagatgctgcttttgaa
aaaatatttaatgtagaaggaaaagggtcagtaaaagagctaatcggaagggtaagacac
actaataaaattgaagagcttcaagagaagttaaagacattttctgtcagaattgtctta
actgcgcatccaactcaattttatcctggaaatgtgctagccatcaatactgatttggaa
gatgccataagaaaggatgatttagcttctattaattcccttatgttacaattaggaaaa
acgccctttataaataaggaaaaacctacgccatatgatgaggcggtcagcctgtgttgg
tatctggaaaatgtattttacaaaagtattcccgctattatttatgatttggtggaggag
ctggaggagccatgggaagattgggtgaatcctgatctattaaccgttgggttttggcct
ggtggcgatagagatgggaaccctttcgtaactcataatattacagttaaagtagccgat
agactaagagagacgattctaaaatgttattatagagatttacgtgcgatcagacgaagg
cttacttttaaaggagtggagaataaaatattggaagcagagcagcatgtatataatgca
ttgtatggagataaatctaaaggctttaaacaacctgaggaattgatagatgttctaagg
gaggcgcttcataaccttagaaatgaacataaggggatattttctgaactattagaaaag
tttatattaaaagtcaggatttttggattccatttttctataatggacatcaggcaagat
agccgtaaacatgatgcattatgggaagatattttgtcaaatgaagatgataagagtatt
gtggctcagtatgagaaaatgcaagaggaggataaaattaatcatcttctaagttttaat
agtcttcctcatgacgttagtatttataatgattttcatcaggagatgttgaaaagcttt
gatgcattagaagaggtgaagaaaagaaatggacatagagcctgtcaccgatacatcatt
agcaattgccaatcggcattacatgtgatggaagtttttcagttggcaaggctcaaatta
agttcggatgcttatgaatcattggatattgtccctctttttgaaaccatcgatgattta
gccaatgcatcaggtgtcatgaaacaattatatgaaattccagcttatcgggagcatgta
aaaaacagaggcgataagcaaactattatggttggtttttctgatggtaccaaagatgga
ggatatttgagagctaactggtctatttttcaagctaaggaagcactcacagaaatttca
agagaatatggtattaaggtcattttctttgatggtaggggtgggccgcctgccagaggc
ggaggtaatatgcatgatttctatgcttctctaggttctaaaattgaagatgaagaagtt
caagtcaccatacagggtcaaaccattagctcaaattacggaaaagttggttcctgtaga
tacaatatggagcaactgctctcggcaggattagaaaatcatctgtttgaaagtgataac
agaatgcttaatgaggaagaacgagaactcttgagtcaattagccgaaattgcatatcag
ctatataaagattttaaaggacatgataaatttacaagttatttaggtgatgtaactcct
ttaaaatattttggagataccaatatcggtagcagaccaactagtagaggtaaaaaaggc
gagttgaaatttgaagacttaagagctattccttttgtaggtgcatgggctcaaatgaaa
cagaacattccaggcttttatggtgtaggaacggctctccatagccttaaaagcaaaggg
aaaggtaaagatgtcaaacaattatatcgagattcgctgtttttcagaacactcttaggg
aactccatgcaatctattgccaaatcattttatcccgctaccgcttatttaagtaaggat
gaagattatggcgagttctggcagctgatgaaaaaggaattcgacttaagcaaagatgaa
ttggacgatataagtggtaaaaaagggattttacatgaagcgccagtttctcaggcatct
attgctatccgagagaagattgtattgcccttaattacgattcaacaatatgccatccag
aagttaagagagggtgttaaagatgaagaaatctataaaaaactcattttacggagtatg
tttggaattgtgaatgctgcaaggaatgcagcttag

DBGET integrated database retrieval system