KEGG   Mycobacterium tuberculosis H37Rv: Rv1058Help
Entry
Rv1058            CDS       T00015                                 

Gene name
fadD14
Definition
(RefSeq) fatty-acid--CoA ligase FadD14
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv1058 (fadD14)
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Rv1058 (fadD14)
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Unknown
   Rv1058 (fadD14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF3659
Motif
Other DBs
NCBI-GeneID: 887133
NCBI-ProteinID: NP_215574
TubercuList: Rv1058
UniProt: A0A089QNA1 O53406
LinkDB All DBs
Position
1180684..1182315
Genome map
AA seq 543 aa AA seqDB search
MYGTMQDFPLTITAIMRHGCGVHGRRTVTTATGEGYRHSSYRDVGQRAGQLANALRRLGV
TGDQRVATFMWNNTEHLVTYFAVPSMGAVLHTLNIRLFPEQIAYVTNEAEDRVILVDLSL
ARLLAPVLPKLDTVHTVIAVGEGDTTPLREAGKTVLRFAELIDAESPDFGWPQIDENSAA
AMCYTSGTTGNPKGVVYSHRSSFLHTMAACTTNGIGVGSSDKVLPIVPMFHANGWGLPYA
ALMAGADLVLPDRHLDARSLIHMVETLKPTLAGAVPTIWNDVMHYLEKDPDHDMSSLRLV
ACGGSAVPESLMRTFEDKHDVQIRQLWGMTETSPLATMAWPPPGTPDDQHWAFRITQGQP
VCGVETRIVDDDGQVLPNDGNAVGEVEVRGPWIAGSYYGGRDESKFDSGWLRTGDVGRID
EQGFITLTDRAKDVIKSGGEWISSVELENCLIAHPDVLEAAVVGVPDERWQERPLAVVVV
REGATVSAGDLRAFLADKVVRWWLPERWAFVDEIPRTSVGKYDKKAIRSRYAEGAYQITE
VHT
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcacgatgcaggactttccgttgacgatcaccgcgatcatgcgccacggctgc
ggtgtccacgggcgacgcacggtcaccaccgcgacgggtgagggctatcggcacagtagc
tatcgcgatgtggggcaacgagctggccagctggcaaatgcgttgcgccgcctcggtgtt
accggggaccagcgggttgccacgttcatgtggaacaacaccgaacacttggtgacctac
ttcgcggtcccgtcgatgggcgcggtgctgcataccctcaacatccggctcttccccgag
cagatcgcctatgtcaccaacgaggccgaagaccgcgtcattctggtcgacttgtcattg
gccagactgctcgcgccggtgctgcccaaactcgacaccgtgcataccgtgatcgcggta
ggagagggcgacacgacgccgctgcgggaagctggcaagaccgtgctgcgcttcgccgaa
ttaattgacgccgaatcccccgacttcgggtggccgcagatcgatgagaactccgcggcc
gcaatgtgttacaccagcggtactaccggcaatcccaaaggcgttgtatacagccatcgt
tcgagctttctgcacacgatggcggcctgcaccacaaacggtatcggggtcgggtccagt
gacaaggtgctgccgatcgtgccgatgtttcatgccaacgggtgggggctaccgtatgcg
gccttgatggcgggtgcggacttggtgctacccgatcggcatctcgacgcccgctcgctg
atccacatggtggagacgctgaagccgacgttggccggcgcggtgccaaccatctggaac
gacgtcatgcattacctagagaaggaccccgatcacgacatgtcatcgctgcgtctggtc
gcctgcggcggatcggcggttccggaatcgctgatgcgcaccttcgaggacaagcacgat
gtccagattcggcagctgtggggcatgacggaaacatcgccgctggccaccatggcctgg
ccgccacctggcaccccggacgaccagcattgggcattccgcatcactcagggccaaccg
gtgtgcggggtggagacccggatcgtcgacgacgatggccaggtgctgcccaacgacggc
aacgccgttggcgaggtggaggttcgcgggccctggattgctggctcgtattacggggga
cgtgacgagtccaagttcgattccggctggttgcgcaccggtgacgtcggccgcatcgac
gagcaaggcttcatcaccctgaccgaccgcgccaaagacgtcatcaagtccggcggtgaa
tggatctcctcggttgagttggagaactgccttatcgcgcacccggacgtgctcgaggcc
gcggtcgtcggcgttcccgacgagcgctggcaggaacggccgctggcggttgtcgtagtt
cgggaaggggccaccgttagtgctggtgatctgcgagcattcctggcggacaaggtcgtt
cgctggtggttgccggagcggtgggcgtttgtcgacgagattccccgcaccagcgtgggc
aagtacgacaagaaggccatccgttctcgctacgccgaaggtgcctaccagatcaccgag
gtgcacacttga

DBGET integrated database retrieval system