KEGG   Mycobacterium tuberculosis H37Rv: Rv1620cHelp
Entry
Rv1620c           CDS       T00015                                 

Gene name
cydC
Definition
(RefSeq) cytochrome biosyntheisis ABC transporter ATP-binding protein/permease CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rv1620c (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv1620c (cydC)
Transporters [BR:mtu02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    Rv1620c (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_membrane AAA_16 AAA_29 FtsK_SpoIIIE AAA_28 Mg_chelatase AAA_22 NACHT AAA_18 CbiA AAA_24
Motif
Other DBs
NCBI-GeneID: 885503
NCBI-ProteinID: NP_216136
TubercuList: Rv1620c
UniProt: O06137
LinkDB All DBs
Position
complement(1819963..1821693)
Genome map
AA seq 576 aa AA seqDB search
MNRPSAVSRRQRDLLAASGLLGPRLPRILAAVALGVLSLGSALALAGVSAWLITRAWQMP
PVLDLSVAVVAVRAFAISRGVLHYCERLATHDTALRAAGRARTLIYHRLAHGPAAAAVGL
HSGDLAARVGADVDELANMLVRALVPIAVAAVLAVAATAVVAAVSVPAAVVLAVCLLVAG
VVAPWLAGRTAAAQEAIARQHRGMRDTSAMIALEHAPELRVAGALRNVIADSQRRQHAWA
DALDAAARTGAIAEAMPTAAIGASLLGAVVAGIGMAPTVAPTTLAILMLLPLSAFEATVA
LPAAAVQLTRSRIAAARLLDLTGSNRVRETESTVSARLPVGTGVLAADVCCGHQEAQSIR
VTIDLPPGARLAVTGASGAGKTTLLMTLAGLLPPVHGRVLLDGTNLSDFDEDELRSAVSF
FAEDAHIFATTVRDNLLTARGDCPDDELIEALDRVGLCGWLAGLPEGLSTVLIGGAQAVS
AGQRRRLLLARAVLSPARIVLLDEPVEHLDAANADLLRDLLAPNSGIMSAMRTVVVATHH
LPNDIQCAELSIATDQRCRRRGTNSSDNNTNASAKT
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaccgagtgctgtgagtcgccgccagcgggacctgctggccgcgtctgggctg
ttgggtccccggttgccccggatcttggcggccgtcgcgctgggcgtgctgtcgctgggc
agcgcgctggccctggccggggtgtcggcctggctgatcactcgggcctggcagatgccg
cccgtcctggacctgtcggtggcggtcgtggcggtgcgggcgttcgcgatttcgcgcggc
gtgctgcactactgcgagcgactggccacccacgacaccgcgttgcgggccgccggccgg
gcccgcacccttatctatcaccggctggcccacggaccggcggcggccgccgtcgggctg
cacagcggggacctggcagcacgcgtcggcgcggacgtcgacgaactggccaacatgctg
gtgcgtgctctggtgccgatagccgtcgcagcggtgctggcagtagccgcgaccgcggtc
gtcgcggccgtttcggtgccagccgccgtggtactggcggtctgccttttggttgccggc
gttgttgcgccctggcttgccggcagaaccgccgcagcgcaggaagcgatcgcccgccaa
catcggggcatgcgcgacacgtcggcgatgatcgcccttgagcatgcccccgagcttcgt
gtcgccggtgccctacgcaacgtcatcgccgactcacaacggcgccaacatgcctgggcc
gatgcgctcgacgccgccgcacgaacgggggcgatcgccgaggccatgccgaccgcggcg
atcggggccagcctgctgggcgccgtggtggccgggatcggcatggcccccacggtcgcg
cccacaacactggccatcctgatgttgttgccgctgtccgcattcgaggcgaccgttgca
ctacccgccgccgccgtccagttgacacggtcgcgcatcgcggcggctcgtctgctcgac
ctgactgggtcaaaccgggtccgcgagaccgaatccacggtgtcggcgcgactgccggta
ggtaccggggtgctagcggccgacgtgtgttgcggtcaccaagaggcgcagtcgatccgg
gtgacgattgacctaccgccgggtgcccggctggccgtcaccggcgcgagcggcgccggc
aagacgacgctgttgatgacgctggccggcttgctgccgccggtgcacggccgggtgttg
ctggacggaactaacctgagcgacttcgatgaggatgaattacgcagcgctgtcagcttt
ttcgctgaagatgcgcatatctttgctaccaccgttcgggacaacttgctgaccgcccga
ggagactgccccgatgacgaactgatcgaggccctggatcgggtcggcctgtgcggctgg
ctcgccggcctgcccgaggggttgtcgacggtgttgatcggtggcgcgcaagcggtctcg
gcgggtcagcgcagaaggttgctgctcgcccgggcggtgctttccccggctcggatcgtg
ttgctcgacgaacctgtcgaacacctcgacgccgccaacgccgaccttctgcgcgatctg
ctggccccgaactccgggatcatgagcgctatgcggaccgtggtggtagccacccaccac
ctgcccaacgacattcaatgcgccgagctgtccatagcgacggatcagagatgtcgccgc
cgcgggacgaactccagcgacaacaacaccaacgccagcgcaaagacctga

DBGET integrated database retrieval system