KEGG   Mycobacterium tuberculosis H37Rv: Rv1925Help
Entry
Rv1925            CDS       T00015                                 

Gene name
fadD31
Definition
(RefSeq) fatty-acid--CoA ligase FadD31
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv1925 (fadD31)
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Rv1925 (fadD31)
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Unknown
   Rv1925 (fadD31)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 885200
NCBI-ProteinID: NP_216441
TubercuList: Rv1925
UniProt: I6Y7V6 L0T839
LinkDB All DBs
Position
2177087..2178949
Genome map
AA seq 620 aa AA seqDB search
MNDGSRQELRVRSGLLQIEDCLDADGGIALPAGTTLISLIERNIKYVGDLVAYRYLDHAR
SAAGCALEVTWTQFGMRLAAIGAHVQRFAGPGDRVAILAPQGIDYVCGFYAAIKAGTVAV
PLFAPELPGHAERLDTALRDSEPAVILTTAAAKNAVEGFLNNVPRLRKPTVLVIDQIPDR
EGELFVPVELDIDAVSHLQYTSGSTRPPVGVEITHRAVGTNLVQMILSIDLLNRNTHGVS
WLPLYHDMGLSMIGFPAVYGGHSTLMSPTAFVRRPLRWIQALSEGSRTGRVVTAAPNFAY
EWAAQRGLPAQGDDVDLSNVVLIIGSEPVSIDAVTTFNKAFAPYGLPRTAFKPSYGIAEA
TLLVATIDHAAEPTVVYLDPEQLGAGHATRVAPDAPNAVVHVSCGHVARSLWAVIVDPDT
GPEAGAELPDGEIGEVWLQGDNVARGYWGRPEETRMTFGARLQSPLAEGSHADGSAIDDT
WLRTGDLGVYLDGELYITGRIADLLTIDGRNHYPQDIEATAAEASPMVRRGYITAFTVPA
SDGDDRNQRLVIIAERAAGTSRSDPRPALDAIRAAVCNRHGLSVADLSFLPAGAIPRTTS
GKLARQACRAQYLSGRLGVH
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacggctcccggcaggaactcagggttcgtagcggcctactacaaatcgaggac
tgcctggatgctgacggcggcatcgcattgccggcaggcaccacgctgatctcgctcatc
gagcgcaacatcaagtatgtcggcgacctcgtggcgtatcgctacctggaccacgcccgt
tcggccgccggatgcgccctggaagtgacctggacgcaattcggtatgcgattagcggcc
ataggtgcacacgtgcaacggttcgcaggccccggcgaccgcgttgcgatcctcgcacca
cagggcatcgactatgtttgcgggttctacgctgcaatcaaggcaggcaccgtcgcggtg
ccgttgttcgcacccgaactgccgggtcacgccgagcgtcttgatacggcacttcgcgat
tcggagccagcggtcatactcacgacggcggcggcgaaaaacgccgttgaaggttttctg
aacaacgttccgcgcctgcgaaagccgacagtcctcgtcatcgatcaaatacccgaccgc
gagggggagctgttcgtcccggtcgagctggacatcgacgccgtatcccacctgcagtac
acctcgggctcgacgcgacccccggtcggtgtcgagatcacccaccgcgcggtcggcacc
aacctggtgcaaatgatcctgtcgatcgacctgctcaaccgaaacacccacggcgtcagt
tggttaccgctgtaccacgacatgggcctatccatgatcggctttccggcggtctatggc
ggacactccaccctgatgtcgcccacggcgtttgtccgcaggccactgcgatggatccag
gcgttgtccgaggggtcgcggaccggacgcgtggtcaccgcggcgccaaacttcgcctac
gagtgggccgcacagcgtggactacccgcgcaaggcgacgacgtcgacctcagcaatgtc
gtgctgatcatcggttccgaaccagtcagcatcgatgcggtgaccacgttcaacaaagcg
ttcgcgccctatggtttaccgcgtacagcgttcaaaccctcgtacggcatagccgaggcg
accctgctcgtcgcgaccatcgaccatgccgctgagccgacggttgtttatcttgaccca
gagcagttgggcgccggacacgcgacgcgcgtcgcgccggatgcgcccaacgccgtcgtg
cacgtgtcgtgtggccatgtggcccgcagcctgtgggccgtgatcgtcgacccggatacc
ggccccgaggcgggcgccgaactgcccgacggtgagatcggtgaggtttggttacaaggc
gacaacgttgctcgggggtattggggacggccggaagaaacgcggatgacgttcggtgcc
cgcttgcaatcaccgctcgccgaaggcagccacgccgacgggtccgcgatcgacgacacc
tggctgcgcaccggagacctcggcgtgtacctcgacggtgagctctacatcaccggtcga
atcgcggatctgctgaccatcgacggccgcaaccactatccgcaggacatcgaggccacg
gccgccgaggcctcgccgatggtgcggcgcggatacataaccgctttcacggtgccggcc
agcgacggggacgaccgcaatcagcgactggtgatcatcgccgaacgtgcggcaggcacc
agtcgcagcgacccgcggccggcgctcgacgcgattcgcgcagcggtttgcaaccgccac
gggttatccgttgcggacctgagtttcctgccggccggcgccattccacgcaccaccagc
gggaagctggctcgccaggcctgccgcgcccaatacctcagcggtcgcctgggcgtgcat
tag

DBGET integrated database retrieval system