KEGG   Mycobacterium tuberculosis H37Rv: Rv2930Help
Entry
Rv2930            CDS       T00015                                 

Gene name
fadD26
Definition
(RefSeq) fatty-acid--CoA ligase FadD26
  KO
K12426  long chain fatty acid CoA FadD26
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv2930 (fadD26)
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Rv2930 (fadD26)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-GeneID: 887603
NCBI-ProteinID: NP_217446
TubercuList: Rv2930
UniProt: P9WQ43 I6Y224
LinkDB All DBs
Position
3243697..3245448
Genome map
AA seq 583 aa AA seqDB search
MPVTDRSVPSLLQERADQQPDSTAYTYIDYGSDPKGFADSLTWSQVYSRACIIAEELKLC
GLPGDRVAVLAPQGLEYVLAFLGALQAGFIAVPLSTPQYGIHDDRVSAVLQDSKPVAILT
TSSVVGDVTKYAASHDGQPAPVVVEVDLLDLDSPRQMPAFSRQHTGAAYLQYTSGSTRTP
AGVIVSHTNVIANVTQSMYGYFGDPAKIPTGTVVSWLPLYHDMGLILGICAPLVARRRAM
LMSPMSFLRRPARWMQLLATSGRCFSAAPNFAFELAVRRTSDQDMAGLDLRDVVGIVSGS
ERIHVATVRRFIERFAPYNLSPTAIRPSYGLAEATLYVAAPEAGAAPKTVRFDYEQLTAG
QARPCGTDGSVGTELISYGSPDPSSVRIVNPETMVENPPGVVGEIWVHGDHVTMGYWQKP
KQTAQVFDAKLVDPAPAAPEGPWLRTGDLGVISDGELFIMGRIKDLLIVDGRNHYPDDIE
ATIQEITGGRAAAIAVPDDITEQLVAIIEFKRRGSTAEEVMLKLRSVKREVTSAISKSHS
LRVADLVLVSPGSIPITTSGKIRRSACVERYRSDGFKRLDVAV
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgaccgaccgttcagtgccctctttgctgcaagagagggccgaccagcagcct
gacagcactgcatatacgtacatcgactacggatccgaccccaagggatttgctgacagc
ttgacttggtcgcaggtctacagtcgtgcatgcatcattgctgaagaactcaagttatgc
gggttacccggagatcgagtggcggttttagcgccacaaggactggaatatgtccttgca
ttcctgggcgcacttcaggctggatttatcgcggttccgctgtcaactccacagtatggc
attcacgatgaccgcgtttctgcggtgttgcaggattccaagccggtagccattctcacg
acttcgtccgtggtaggcgatgtaacgaaatacgcagccagccacgacgggcagcctgcc
ccggtcgtagttgaggttgatctgcttgatttggactcgccgcgacagatgccggctttc
tctcgtcagcacaccggggcggcttatctccaatacacgtccggatcgacgcgtacgccg
gccggagtcattgtgtcgcacacgaatgtcattgccaatgtgacacaaagtatgtacggc
tatttcggcgatcccgcaaagattccgaccgggactgtggtgtcgtggctgcctttgtat
cacgatatgggcctgattctcggaatttgcgcaccgctggtggcccgacgccgcgcgatg
ttgatgagcccaatgtcatttttgcgccgtccggcccgctggatgcaactgcttgccacc
agcggccggtgcttttctgcggcaccgaatttcgccttcgagctggccgtgcgcagaaca
tctgaccaggacatggcggggctcgacctgcgcgacgtggtcggcatcgtcagtggcagt
gagcgaatccatgtggcaaccgtgcggcggttcatcgagcggttcgcgccgtacaatctc
agccccaccgcgatacggccgtcgtacgggctcgcggaagcgaccttatatgtggcagct
cccgaagccggcgccgcgcccaagacggtccgttttgactacgagcagctgaccgccggg
caggctcggccctgcggaaccgatgggtcggtcggcaccgaactgatcagctacggctcc
cccgacccatcgtctgtgcgaatcgtcaacccggagaccatggttgagaatccgcctgga
gtggtcggtgagatctgggtgcatggcgaccacgtgactatggggtattggcagaagccg
aagcagaccgcgcaggtcttcgacgccaagctggtcgatcccgcgccggcagccccggag
gggccgtggctgcgcaccggcgacctgggcgtcatttccgatggtgagctgttcatcatg
ggccgcatcaaagacctgctcatcgtggacgggcgcaaccactaccccgacgacatcgag
gcaacgatccaggagatcaccggtggacgggccgcggcgatcgcagtgcccgacgacatc
accgaacaactggtggcgatcatcgaattcaagcgacgcggtagtaccgccgaagaggtc
atgctcaagctccgctcggtgaagcgtgaggtcacctccgcgatatcgaagtcacacagc
ctgcgggtggccgatctcgttctggtgtcacctggttcgattcccatcaccaccagcggc
aagatccggcggtcagcctgcgtcgaacgctatcgcagcgacggcttcaagcggctggac
gtagccgtatga

DBGET integrated database retrieval system