KEGG   Mycobacterium tuberculosis H37Rv: Rv2950cHelp
Entry
Rv2950c           CDS       T00015                                 

Gene name
fadD29
Definition
(RefSeq) long-chain-fatty-acid--AMP ligase FadD29
  KO
K21059  4-hydroxyphenylalkanoate adenylyltransferase [EC:6.2.1.51]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.51  4-hydroxyphenylalkanoate adenylyltransferase FadD29
     Rv2950c (fadD29)
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Rv2950c (fadD29)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2 Mur_ligase_C DUF4012
Motif
Other DBs
NCBI-GeneID: 887202
NCBI-ProteinID: NP_217466
TubercuList: Rv2950c
UniProt: P95141 I6YAP0
LinkDB All DBs
Position
complement(3300596..3302455)
Genome map
AA seq 619 aa AA seqDB search
MKTNSSFHAAGEVATQPAWGTGEQAAQPLNGSTSRFAMSESSLADLLQKAASQYPNRAAY
KFIDYDTDPAGFTETVTWWQVHRRAMIVAEELWIYASSGDRVAILAPQGLEYIIAFMGVL
QAGLIAVPLPVPQFGIHDERISSALRDSAPSIILTTSSVIDEVTTYAPHACAAQGQSAPI
VVAVDALDLSSSRALDPTRFERPSTAYLQYTSGSTRAPAGVVLSHKNVITNCVQLMSDYI
GDSEKVPSTPVSWLPFYHDMGLMLGIILPMINQDTAVLMSPMAFLQRPARWMQLLAKHRA
QISSAPNFGFELAVRRTSDDDMAGLDLGHVRTIVTGAERVNVATLRRFTERFAPFNLSET
AIRPSYGLAEATVYVATAGPGRAPKSVCFDYQQLSVGQAKRAENGSEGANLVSYGAPRAS
TVRIVDPETRMENPAGTVGEIWVQGDNVGLGYWRNPQQTEATFRARLVTPSPGTSEGPWL
RTGDLGVIFEGELFITGRIKELLVVDGANHYPEDIEATIQEITGGRVVAIAVPDDRTEKL
VTIIELMKRGRTDEEEKNRLRTVKREVASAISRSHRLRVADVVMVAPGSIPVTTSGKVRR
SASVERYLHHEFSRLDAMA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaactcgtcatttcatgccgcgggcgaggtggcgacacaaccggcatggggc
accggtgagcaagcggcacaaccgctgaacgggagcacatcgcgattcgctatgagcgag
tcgtcgctcgctgatctcctacagaaggcggcgagccagtaccccaatcgcgcggcgtac
aagttcattgactatgacacggatccggctggcttcaccgaaaccgtgacgtggtggcaa
gtccaccggcgagcgatgatcgtggcagaggagctctggatatacgcgtcaagcggtgat
cgggtcgcgatattggccccgcagggccttgaatacatcatcgcctttatgggtgtgctg
caggctggtctcattgcggttcctcttccggtgccacaattcggcattcacgacgaacga
atatcttcggcattacgagactctgcgccgtccattattcttacgacctcgtcggttatt
gacgaggtcacgacatatgcgccacatgcgtgcgccgcacagggccagtccgcgcccatc
gtcgtggctgtggacgctctggacttgagctcatccagagcgctcgatccgactcggttc
gagcgtccgagcacagcatatctacagtacacatccggttcgacccgcgcgccggccggt
gttgtcctctcgcacaagaatgtcatcaccaactgcgtacagctaatgtccgattacatc
ggggattcggaaaaggttccgtcaactcccgtatcgtggctgccgttctatcacgacatg
gggttgatgctgggcatcattctcccgatgatcaatcaagacaccgcggtgttgatgagt
cccatggcattcttgcagcggccggcccgttggatgcaattattagccaaacaccgcgca
cagatttccagcgcaccgaatttcggtttcgaattggcggtacgcagaacatccgacgac
gatatggctggacttgacctcgggcatgtgcggacgatcgtcaccggcgccgaacgagta
aacgtcgcgacgctgcggcgcttcaccgagcggttcgccccgttcaacctcagcgagacg
gcaatccggccgtcatatgggctcgcggaggcgacggtgtacgtggcgaccgccggaccg
ggacgcgcgccgaagagtgtttgctttgactaccagcagctgtcggtcggtcaggcgaag
cgtgccgagaacggcagcgagggagccaacctggtgagttatggagctccccgggcgtca
accgtgcggatcgtcgaccccgaaaccaggatggagaatcccgcggggacggttggcgaa
atctgggtgcagggagacaacgtcggcttgggctactggcgcaacccgcagcagacggag
gcgacgttccgcgcgcggctcgtcactccctcgcccgggacttcggaaggtccgtggctg
cggaccggagacctcggcgtcattttcgagggcgaactgttcatcacgggtcgcatcaag
gagctgttggtggtggatggggccaaccactatccggaagacatcgaggcgacgatccag
gaaatcaccggcggccgggttgtggcgattgcggtgcccgatgaccgtactgaaaagctg
gtaaccattatcgaactcatgaagcggggtcgcacagatgaggaggaaaagaatcgactc
cgcaccgtcaaacgtgaagtcgcctccgcgatatccaggtcacatcgtctgcgcgtcgcg
gatgtcgttatggtggcgccgggttctattccggtcaccaccagcggtaaggttcggcgt
tcggccagcgttgagcgttacctacatcacgaattcagccgcctagatgctatggcataa

DBGET integrated database retrieval system